CAZyme Information: MGYG000003642_02501

Basic Information

• Species: RUG572 sp900771305
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900771305
• CAZyme ID: MGYG000003642_02501
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		38206.29	9.4836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003642	3810265	MAG	Fiji	Oceania

• Gene Location: Start: 3662; End: 4735 Strand: +

Full Sequence      

MAKKFIVACGGTGGHTFPGLAVARELKARGHEVTVWASGRSIEGSVMKSWDGAVFSTGAR
PLSLRNALFNLLSILRCRREMKRAKPDALLAMGSYSSLPPVLSAKARNVPLVLHEANTIP
GRAVDFLARYASMVAISFEETARHLPGRKTVLTGLPVRTEISGQPRLDEVPPDAFCVFVT
GGSQGAHRVNELVSSALVLVNDELEGRGVKKKLFVIHQTGAADESFVKECYAKAGIPARV
QAFEREMGRAFASADLVVCRAGASTIFELALVGKPAFLIPLPSAMRNHQHFNAMALVDKG
AADEGIQESLTPRAIANYILNKAEHPELLEKKSAAMKAAATPDAAARVADILEQVCC

Enzyme Prediction     

No EC number prediction in MGYG000003642_02501.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	177	344	5.9e-43	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	2.39e-103	3	330	2	329	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	4.39e-102	4	330	1	329	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	7.71e-89	3	353	1	352	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	4.48e-80	3	330	1	326	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	7.84e-38	177	330	2	148	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI70731.1	2.51e-90	1	354	1	356
QBG47271.1	1.86e-85	4	355	6	361
AKJ64377.1	6.79e-77	7	354	10	358
CBE69347.1	1.92e-66	4	354	2	360
BCS52295.1	1.12e-63	4	354	2	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	8.40e-46	1	355	1	354	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	4.64e-44	3	355	7	353	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	1.30e-43	3	355	10	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5G8K0	3.12e-63	4	356	2	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Geotalea uraniireducens (strain Rf4) OX=351605 GN=murG PE=3 SV=1
Q39YL9	9.34e-62	4	350	2	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=murG PE=3 SV=1
B9M172	1.95e-61	4	350	2	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32) OX=316067 GN=murG PE=3 SV=1
Q313Q3	3.63e-60	3	348	2	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20) OX=207559 GN=murG PE=3 SV=1
Q1D0T0	1.85e-59	4	351	3	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003642_02501.