CAZyme Information: MGYG000003643_01488

Basic Information

• Species: W1P29-020 sp900771325
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; W1P29-020; W1P29-020 sp900771325
• CAZyme ID: MGYG000003643_01488
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	MGYG000003643_159|CGC1	50567.51	9.0574

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003643	2426387	MAG	Fiji	Oceania

• Gene Location: Start: 11412; End: 12845 Strand: +

Full Sequence      

MKSLLIGSLLMAAGVATAAVTEVRFEPNGVPAFLGRNDLQQGKLVVVADKEAKQEYVRVS
ITGTKPADVKTIRAGEVKGSVMGDKLSFRLPVKAGTNEFPVKIEPSPKADIGRKVVLEGK
AVRLGSLVTRPGQKVTDAGRNSKNFRIPGIVETPKGTLVAVFDNRFNHAGDLPADITVGV
SVSKDKGNTWSPIRTAISCKDLPGGSGIGDPAILCDPSNGRIWVAALRAPNAGHPIWKSS
TGTVDPKACGQFILAYSDNEGQSWSKPINITEEIKRLADPDTKDWGLVFQGPGAGIAMTD
GTLVFPAQIWGNKGSAPHHGVLVYSKDHGKTWASSKAMPFGGSESTVAETTDGALLLNTR
EGGGGLRVTGRTTDLGQTWTKLETSPLRQPVCQGALLAMNKKLYFSNPNSGKRDTMTVRA
SADDGKTWNAGIVYDPRGCAGYSSLCSVGEDSLGVLYEGNSDYLYFLRIPLAEIDGE

Enzyme Prediction     

No EC number prediction in MGYG000003643_01488.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	139	468	2e-80	0.9502923976608187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	3.54e-86	141	475	10	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.69e-18	174	455	16	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13859	BNR_3	2.32e-15	254	380	92	212	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	7.07e-14	142	461	272	646	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
PTZ00334	PTZ00334	2.78e-04	291	381	261	348	trans-sialidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQL43892.1	5.15e-145	92	474	134	557
QWO92853.1	2.90e-100	33	474	218	675
QWO85546.1	2.90e-100	33	474	218	675
QWO95381.1	2.90e-100	33	474	218	675
QWO91841.1	2.90e-100	33	474	218	675

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MNJ_A	6.89e-79	86	474	129	537	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
6MYV_A	2.83e-74	95	474	118	520	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	5.37e-74	95	474	139	541	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
4FJ6_A	1.16e-71	56	474	77	520	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
4Q6K_A	3.29e-65	95	474	121	523	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	7.40e-71	95	474	140	542	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P15698	6.88e-28	141	465	50	387	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1
Q02834	1.95e-26	144	476	66	403	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P10481	2.17e-24	141	465	32	369	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1
Q4WQS0	3.77e-22	131	460	46	376	Exo-alpha-sialidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G13800 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000356	0.998905	0.000192	0.000177	0.000167	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003643_01488.