CAZyme Information: MGYG000003644_00336

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia
• CAZyme ID: MGYG000003644_00336
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277		31395.56	4.4533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003644	2073085	MAG	Fiji	Oceania

• Gene Location: Start: 1336; End: 2169 Strand: +

Full Sequence      

MYCQNRIVYTVQEGDSLYRLARQYDTTVTELILGNPGVNPYNLQIGMRLHICPGAGYEGP
MPTPEGTNQNRPGMPVMPGTPGTPSMPSVPSMPGTPNTETPSEQENMVESLMRAMRLSWL
DLIYWTRMYLMSVDAGSRDQQEIEERALQAADEITDVFANHLPIATTRQLRNLLTEHVEL
TGDLIRTQKEGNMENYDALIKEWYGNANQLASLLGEINPYFSGRETRNMLLNYLDMTRES
IEQQLNGEYGMSIDTFRDLKKQVLEMADYLGRGLLAR

Enzyme Prediction     

No EC number prediction in MGYG000003644_00336.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.37e-12	7	51	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.24e-11	9	49	2	42	Lysin motif.
pfam01476	LysM	1.55e-10	9	51	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
COG3858	YaaH	6.27e-06	6	60	49	103	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
COG1388	LysM	1.25e-04	8	40	68	100	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97639.1	2.36e-112	1	277	1	293
VCV20845.1	4.37e-109	1	277	1	288
CBL07700.1	5.35e-109	1	277	7	294
CBL13717.1	5.35e-109	1	277	7	294
QDX95442.1	1.92e-32	9	275	11	248

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003644_00336.