CAZyme Information: MGYG000003644_00433

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia
• CAZyme ID: MGYG000003644_00433
• CAZy Family: CE17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		43074.63	5.4381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003644	2073085	MAG	Fiji	Oceania

• Gene Location: Start: 3326; End: 4474 Strand: -

Full Sequence      

MQETFAVDYKRGISNLGNPDRILNVMARAMRGETLRIGFIGGSITQGSLSSAPDTCYAYL
VYQWWCKTFPKAEFMYINAGIGGTTSQFGVARVEEDLLAKKPDFVIVEFSVNDESTEHFM
ETYEGLVRRILNASQKPAVMLVHNVYYHNGANAQLMHGRIARHYDLPAVSMQSTIYPEVV
AGRIENRKITPDDLHPNDEGHALVASVIAYFLREMYEQEVFAEGVMQQDRRESPDTSLPL
PLTRNEYEHSMRYRNNSSAPVLQGFVADQTPQTDITDCFRNGWTASKMGDTITFQVEGSC
VAVQYRKSVQKPAPIAEVIVDGNKKGSVRLDANFDETWGDKLELATVLEHSDKRMHEVRI
RIVETHEDDAVPFYLVSVIGSR

Enzyme Prediction     

No EC number prediction in MGYG000003644_00433.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE17	39	202	7.9e-82	0.9939393939393939
CBM35inCE17	235	381	4.8e-65	0.9798657718120806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00229	SGNH_hydrolase	1.99e-25	37	211	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam13472	Lipase_GDSL_2	1.66e-21	39	203	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01834	SGNH_hydrolase_like_2	1.64e-16	36	209	3	189	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd01822	Lysophospholipase_L1_like	2.96e-09	77	213	40	177	Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.
cd04501	SGNH_hydrolase_like_4	2.13e-08	36	208	2	179	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEV02614.1	1.56e-187	5	381	3	369
CBL10432.1	1.28e-186	5	381	3	369
CBL12377.1	1.28e-186	5	381	3	369
AEN97394.1	4.19e-184	7	381	5	381
BCN32107.1	6.21e-156	5	381	3	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HH9_A	7.09e-189	5	381	3	369	Crystalstructure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_B Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_C Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_D Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82]
6HFZ_A	3.17e-185	5	381	3	369	Crystalstructure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_B Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_C Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_D Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82]
1YZF_A	1.75e-07	36	208	3	182	Crystalstructure of the lipase/acylhydrolase from Enterococcus faecalis [Enterococcus faecalis V583]
4OAO_A	4.25e-07	32	215	4	211	Amutant of Axe2 (R55A), and acetyl-xylooligosaccharide esterase from Geobacillus Stearmophilus [Geobacillus stearothermophilus],4OAO_B A mutant of Axe2 (R55A), and acetyl-xylooligosaccharide esterase from Geobacillus Stearmophilus [Geobacillus stearothermophilus]
3W7V_A	4.25e-07	32	215	4	211	CrystalStructure of Axe2, an Acetylxylan Esterase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],3W7V_B Crystal Structure of Axe2, an Acetylxylan Esterase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q09LX1	2.33e-06	32	215	4	211	Acetylxylan esterase OS=Geobacillus stearothermophilus OX=1422 GN=axe2 PE=1 SV=1
P0ADA1	2.78e-06	28	215	23	203	Thioesterase 1/protease 1/lysophospholipase L1 OS=Escherichia coli (strain K12) OX=83333 GN=tesA PE=1 SV=1
P0ADA2	2.78e-06	28	215	23	203	Thioesterase 1/protease 1/lysophospholipase L1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=tesA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003644_00433.