CAZyme Information: MGYG000003644_00661

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia
• CAZyme ID: MGYG000003644_00661
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000003644_254|CGC1	41684.93	4.4887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003644	2073085	MAG	Fiji	Oceania

• Gene Location: Start: 731; End: 1813 Strand: -

Full Sequence      

MRRKKIVFVIAGIIILLFVVWGVGSVTANRRIRFANQLGSGINLGNSLEATGLRQYKSDA
ADLEYEVFWGNPEISREQFSAIRQAGFSSVRIPVTWQDHMDEEGTVSEIWMNRVTEVVDM
ALEENLYVILDTHHEEWLNLETEREQEICDTYRSLWTQIAQQFQEYDEHLLFEGMNEPRL
RKSEHEWDAGTPEMRAMVNRLNEAFIESVRETGGENRERYLLISAYASGTEEEALEDLVV
PEGNIIVAVHMYLPYSFCQDEDGITQWDDPSGETRAQVEKVFANLERLFIKKHIPVIITE
FGCKDKGNEEERAAWINFYRKLADAGGIPCFWWDNGSNYQILNRNNGKWVYPKLVEALVK

Enzyme Prediction     

No EC number prediction in MGYG000003644_00661.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	66	336	1.2e-89	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	7.71e-55	65	338	15	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.19e-22	41	360	54	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam13624	SurA_N_3	0.006	1	26	5	33	SurA N-terminal domain. This domain is found at the N-terminus of the chaperone SurA. It is a helical domain of unknown function. The C-terminus of the SurA protein folds back and forms part of this domain also but is not included in the current alignment.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX64856.1	2.24e-103	32	359	62	383
AFL98798.1	1.44e-102	13	359	10	364
CCO06082.1	6.68e-86	37	358	61	378
AOZ95201.1	5.00e-85	37	360	89	414
ADK66823.1	3.60e-84	41	360	43	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W85_A	3.62e-81	41	359	15	336	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W85_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W87_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W87_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W89_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium],4W89_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium]
4W86_A	1.83e-78	41	359	15	336	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose and TRIS [uncultured bacterium],4W86_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose and TRIS [uncultured bacterium]
4W84_A	1.89e-78	41	359	15	336	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W84_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W88_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with a xyloglucan oligosaccharide and TRIS [uncultured bacterium],4W88_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with a xyloglucan oligosaccharide and TRIS [uncultured bacterium]
6PZ7_A	1.29e-77	33	359	11	334	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
6Q1I_A	3.52e-77	37	360	20	351	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23660	2.99e-77	24	360	20	361	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P23661	1.71e-75	37	360	77	398	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1
P54937	1.86e-75	37	360	45	376	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P16216	9.75e-74	40	357	78	393	Endoglucanase 1 OS=Ruminococcus albus OX=1264 GN=Eg I PE=1 SV=1
P28623	3.40e-67	22	360	37	370	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.804679	0.187531	0.004856	0.000532	0.000358	0.002051

TMHMM  Annotations     

start	end
7	29