CAZyme Information: MGYG000003644_01311

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia
• CAZyme ID: MGYG000003644_01311
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		38430.47	4.671

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003644	2073085	MAG	Fiji	Oceania

• Gene Location: Start: 451; End: 1494 Strand: -

Full Sequence      

MQIITVSPEASASGAFHCIQDAIDSIPASNQEPVRIELAPGIYREKLTLEKPFVTLVGTG
KAPADTVITYDDFGNDTMPDGTRRGTFRSYTLFVHATDVTLRNLTVENASGDSDTHGQAI
ALYAECERFFADSCRLLGHQDTLFTGPLPPKELQANGFLGPTQFAPRINGRQYYRNCYIC
GDVDFIFGSATAYFEHCTLESLRRSKIDDDALPAASATDNLSPEGYVTAASTPEGQEYGY
VFANCEFISHDCPPASVYLGRPWRDYAKTVLIDCALGSHIHPAGFHDWNKTHAHESIFYA
EYQSHPQDSHNARADFVHTLDTTDAVHFSRENVLSGTDNWIPWENEV

Enzyme Prediction     

No EC number prediction in MGYG000003644_01311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	335	2.5e-84	0.9756944444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	8.97e-75	10	304	87	374	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	4.40e-58	4	341	11	292	putative pectinesterase
pfam01095	Pectinesterase	6.70e-48	4	303	2	260	Pectinesterase.
PLN02773	PLN02773	1.78e-47	3	343	6	304	pectinesterase
PLN02682	PLN02682	8.59e-45	4	342	71	368	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN98064.1	1.31e-153	1	342	1	332
CBL11054.1	5.06e-150	16	342	14	365
VCV23720.1	2.05e-149	16	342	14	365
CBL08524.1	2.05e-149	16	342	14	365
ABX41678.1	5.50e-117	4	342	5	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	5.40e-28	5	304	4	268	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.38e-27	13	304	12	264	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	1.02e-25	6	290	8	281	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	1.10e-22	3	309	34	323	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1C_A	5.99e-19	12	343	15	294	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.58e-36	2	343	5	304	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q43043	4.30e-36	1	304	50	319	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q9FM79	1.81e-35	19	341	95	378	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8GXA1	1.07e-33	13	342	265	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9SIJ9	1.51e-33	4	341	49	332	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003644_01311.