CAZyme Information: MGYG000003644_01437

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia
• CAZyme ID: MGYG000003644_01437
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672		76119.31	5.5697

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003644	2073085	MAG	Fiji	Oceania

• Gene Location: Start: 1948; End: 3966 Strand: -

Full Sequence      

MALYSSEKALNMKITVSNVVKGVRYLKHYGFKEFLIRLQEKKEAENVPYEPWYERHKATE
EQLIRQRKEASKWKDAPVVSIVVPLYCTKEAFLREMIESVQAQSYENWQLCLADASPLAE
IGQQTHDGAIHADAMDETKLPVTGRIVREYMEADTRIIYRKLEQNLGIAENTNAAIELAT
GDWIAFMDHDDLLAPDALYEAVSLIRRGVGRGTAVENASLLHSQENGAEYEMIYTDEDKV
DMEGKMHFQPHFKPDINIDLLRSNNYITHFTLVSRALLERVGGIRAEFDGAQDYDFILRC
VEQAKAVGHVPRVLYHWRCHQESTSSNPFSKQYTVDAGKRAIEEHLKRVGVTGEVAATKD
MGFYTVRYPVAGEPLVSVIIPNKDEVESLKKCLAAIEKSSYRNYEVIIVENNSCDDTFAY
YRSIAPDCSEKDGVICYEGRLVGGQRLCVAVWKDGFNYSKLNNFGVSFARGEYLVLMNND
IEVISTEWLSEMLGTCQRTEVGVVGAKLYYPDDTVQHAGIVVGIGGNVRGIGQNMFTGLR
RERSGYLHKASLAMDYSAVTAACLMTGRSVYDRVGGFTEELTVAFNDVDFCLKVRALGML
VVYQPRVEAYHYESKSRGSEDTPEKVARFQKEIEYMREKWIGILKNGDPYYNPNFSPYAT
DYALRDNSRGLL

Enzyme Prediction     

No EC number prediction in MGYG000003644_01437.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	143	281	8.2e-18	0.7470588235294118
GT2	377	519	7.7e-17	0.7411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.69e-95	77	319	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.40e-33	378	613	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.76e-25	372	619	1	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.64e-22	80	253	1	157	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	2.00e-19	80	326	1	202	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97496.1	0.0	11	666	13	646
VCV23340.1	0.0	1	668	1	658
CBL08069.1	0.0	8	668	2	646
CBL12630.1	0.0	8	668	2	646
CBL21583.1	3.88e-244	13	665	18	609

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	5.39e-137	75	664	364	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	5.20e-90	77	665	319	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	1.10e-10	75	332	6	226	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
O32268	3.73e-07	71	198	2	104	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
Q57022	8.84e-07	77	329	4	212	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003644_01437.