CAZyme Information: MGYG000003645_00473

Basic Information

• Species: CAG-831 sp900771335
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900771335
• CAZyme ID: MGYG000003645_00473
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
827		93304.82	5.1585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003645	1892545	MAG	Fiji	Oceania

• Gene Location: Start: 5406; End: 7889 Strand: -

Full Sequence      

MRKLLFVFGLLLASYFLSAQSWVRVNQAGYLPTDIKVAVLISLDEAEGSFEVCDAITDEV
VFKGKGTSANASKWGMKKAYRLDFSSISKDGGYYIRSNGAKSPVFEIGADVYDGIADYLL
VYMRQQRCGDNPFNGEPCHQHDGFIVDHPTRSGEKIDVTGGWHDATDYLQYLTTSATTTY
HMLFAYMEAEDKSVFKDLYDARGRKGSNGIPDILDEAKWGLDWLVKMNPEDRVMFNQIAD
DRDHAGFRVPYKDTVDYGWGPGAGRPVYFVTGERQGLSKYVNRTTGVSSSAAKFASTFAL
GAQVMRNYYPEFSDMILYKAEQAYAYATEDVGNTQTACVVSPFFYEEDSFVDDIELAAAT
FMHFTGQDNWKQQADYWGELEPVSPWMELGRGRHYQFYPFINIGHYYMAKSSDKAISSKY
AEFMRQGLQYLKDRAADDPFLSGVPYIWCSNNLVSAAVSQARLYNEVTGDNSFMEMEVAL
RDWLLGCNPWGTSMIVGYPSFADYPDYPHSSYFVVNGDLTYGGLVDGPVYYTVFKERADK
YMDISENPYNPFNNGIAVYHDDLQDFSTNEPTMDGTAGLTYYFGKMESKGSALKKTQRVK
DSQGATVRVNPDEKKVYFIFSADTRFNGGPHILKTLKKAGIKGSFFLTGNCLRMEEHKEL
IENIIADGHYVGGHSDNHLLYAPWEARDSSLVTRDSLIRDLQLNMAELEKFGIGHDDARW
FLPPYEYYNLDHVKWLENSGIKVMNLTPGTATAADYTTADMPNYKSSQTLINKLLEFEKN
VGLNGAIILIHPGVESGRPDPLYHRLPEIIKTLKKRGYTFGTFSDLK

Enzyme Prediction     

No EC number prediction in MGYG000003645_00473.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	112	581	1.8e-70	0.9880382775119617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	4.15e-57	120	581	7	372	Glycosyl hydrolase family 9.
cd02850	E_set_Cellulase_N	4.50e-25	22	107	1	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam02927	CelD_N	5.56e-25	21	102	1	83	Cellulase N-terminal ig-like domain.
cd10917	CE4_NodB_like_6s_7s	2.60e-24	626	814	7	171	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.
cd10944	CE4_SmPgdA_like	1.04e-21	614	822	1	189	Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53377.1	0.0	1	820	1	828
QIK60909.1	0.0	20	823	23	826
QIK55492.1	0.0	19	823	22	826
AHW60805.1	0.0	4	820	6	812
QIA07887.1	0.0	2	820	4	813

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U2O_A	5.59e-35	31	591	2	545	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
3X17_A	1.12e-34	23	581	18	551	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
5U0H_A	1.46e-31	31	591	2	545	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
6DHT_A	5.57e-25	23	509	18	497	Bacteroidesovatus GH9 Bacova_02649 [Bacteroides ovatus ATCC 8483]
4CJ0_A	3.82e-23	20	497	27	482	ChainA, ENDOGLUCANASE D [Acetivibrio thermocellus],4CJ1_A Chain A, ENDOGLUCANASE D [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23658	6.33e-25	23	330	4	285	Cellodextrinase OS=Butyrivibrio fibrisolvens OX=831 GN=ced1 PE=1 SV=1
A7LXT3	3.38e-24	23	509	32	511	Xyloglucan-specific endo-beta-1,4-glucanase BoGH9A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02649 PE=1 SV=1
P14090	6.94e-24	23	592	341	913	Endoglucanase C OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cenC PE=1 SV=2
P0C2S4	2.09e-22	20	497	27	482	Endoglucanase D (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celD PE=1 SV=1
A3DDN1	2.28e-22	20	497	51	506	Endoglucanase D OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001401	0.997662	0.000376	0.000187	0.000174	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003645_00473.