CAZyme Information: MGYG000003645_00728

Basic Information

• Species: CAG-831 sp900771335
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900771335
• CAZyme ID: MGYG000003645_00728
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000003645_22|CGC1	42979.73	9.0564

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003645	1892545	MAG	Fiji	Oceania

• Gene Location: Start: 1786; End: 2928 Strand: +

Full Sequence      

MRYYIIAGEASGDLHGSNLMKGLYAADPECDVRFWGGDKMASVGGKMVRHYKETAVMGFV
EVLAKAGKVLNNLSRCKKDILEYRPDVVILIDYAGFNLKIARFAKKHGIRTFYYIAPKVW
AWKEGRLKNLRRDVDKLFIIFPFEIEYFQKKNIDVIYRGNPLIDSIANHRCTHESREEFL
QRHSLEDKPIIALLAGSRKNEIGWLLPRYVEAVRLMPQEYQFILAGAPSIEEEYYSKFIS
GTNIKLIKDDTYGAIKHAEAAVVASGTASLETALIGTPQVVCYGGNPITIWIAKQFILRS
GSISYISLGNLIINKLAFRELIQEECTGKTISDEVQRLTSDSAYREEMINKYGEIRQALG
NEGASVKIAKAMIEELKNNK

Enzyme Prediction     

No EC number prediction in MGYG000003645_00728.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	360	1.7e-113	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.17e-118	1	380	2	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.39e-112	1	377	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.67e-82	4	360	2	360	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.06e-76	5	374	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.72e-61	1	376	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53532.1	2.61e-142	1	376	1	370
BAX81022.1	2.02e-130	1	376	1	373
QEM12843.1	4.69e-128	1	380	1	371
BCG53033.1	6.60e-127	1	376	1	373
AWA29599.1	2.18e-126	1	378	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	8.73e-44	5	374	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.70e-43	5	374	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	8.89e-75	2	376	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	2.43e-74	2	369	8	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
B6J9H1	1.11e-73	5	372	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
B6J161	1.11e-73	5	372	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	1.11e-73	5	372	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003645_00728.