CAZyme Information: MGYG000003645_01261

Basic Information

• Species: CAG-831 sp900771335
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900771335
• CAZyme ID: MGYG000003645_01261
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
279	MGYG000003645_36|CGC1	32246.88	5.1029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003645	1892545	MAG	Fiji	Oceania

• Gene Location: Start: 54906; End: 55745 Strand: +

Full Sequence      

MKEPKRVLFVNSEIFPYLPESEISLIGRYLPQGIQEGGKEIRSFMPRYGCINERRNQLHE
VIRLSGMNIVVNDIDRPLVIKVSSISAARMQVYFIDNEDYFHRKFIYSDADGKLFEDNDE
RAAFFARGILETVKKLRWKPDIIHCQGWISHILPIYLKKAYSEDPIFADTKVVLTLYNEH
LDQTFSQDIKEKILMNGIKAGDLDVLSEPNGINLAKLAIQYADGVIMGEESVNTELVDYT
SKKGLPTLPFEKFDQTNQECIQRYNIFYDQFIKNSGDVE

Enzyme Prediction     

No EC number prediction in MGYG000003645_01261.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	6	227	2.3e-44	0.4470338983050847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	2.46e-57	7	226	1	214	Starch synthase catalytic domain.
PRK14098	PRK14098	1.83e-42	6	238	7	237	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	6.20e-36	6	225	1	212	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	1.80e-27	6	225	2	201	glycogen synthase GlgA.
COG0297	GlgA	1.03e-20	6	226	2	213	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKG78761.1	5.06e-121	1	278	1	275
AGY54414.1	4.16e-120	18	272	1	255
SNV43872.1	8.29e-116	5	274	4	269
ADY34094.1	8.29e-116	5	274	4	269
BAX80299.1	2.93e-115	3	272	2	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNF_A	8.18e-06	7	178	24	202	GranuleBound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_B Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_C Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3EGV0	4.55e-42	6	223	7	222	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
Q3B6C3	4.67e-40	6	223	7	222	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B4S584	4.80e-40	6	279	7	283	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1
A1BIY8	9.03e-40	6	223	7	222	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
B4SC83	2.43e-39	6	279	7	283	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003645_01261.