CAZyme Information: MGYG000003648_01412

Basic Information

• Species: NK4A136 sp002314855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; NK4A136; NK4A136 sp002314855
• CAZyme ID: MGYG000003648_01412
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
759	MGYG000003648_196|CGC1	86377.14	4.6647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003648	3786163	MAG	Fiji	Oceania

• Gene Location: Start: 9690; End: 11969 Strand: -

Full Sequence      

MNQSFSTLIVIKPDDFDRQKRNYKRLVNNLQTDNIIFVSSEPIKELIANADLGSSIGFVD
ESSLIPFDTVHKVMEKHLAEILQGESCPRGATGWYYQQFLKMQYARVCKDEFYMVWDGDT
IPCRPINMFSEAGAPYLDLKYEYHEAYFETLEVLLPGMRKCIKKSFISEHMLISTKLMCQ
LLDKIESNSLIEGDTFWEKIIHAIPPRRIVDSAFSEFETYGTFVCFTDPGLYKLREWHSF
RLGAEFFNPNEITDRDYEWLGKDFHAISFEKNQEVREDHNNLFNNPEYQSKLSARKMLEI
AQEEFNGGYIEIWDDNADSALLMDPLSSSNTKKSPIFQPEDEMYEKMGDILSLTNINQAY
LCYENAAFLSSDSELIKRCEDKITRLKDSGRLSVKKASIAIVSYNKKELLQQCIWSIEEH
CAPGSFEIVVVDNASTDGVAKWLSTQSEKMTVLLSDENLGFAGGCNACIKYAAPDTDIFL
LNNDTRMTRNALFWLRMGLYEDDKVGATGCTANFCGNEQDVPVSFSQPSQYVTYAKGVNV
PMANPYEEKSRLCGFAMLIRREAINIVEGLDEGFGLGYFEDDDISLRIRQAGYRLVVCHN
SFIYHQGSASFGNKPGVQELLSHNYEYIKKKWGYDCLMNAVVSKNEKEILSKLPNTTFRF
LEIGCGSGNFLSMVKYQHPDATVLGIERVPDAVKYGVTSIPILLCDIMKDTIPFQDGYFD
VIVVNQRDDNIYEVSKLAEILAKYVVPGGQLLLASADEN

Enzyme Prediction     

No EC number prediction in MGYG000003648_01412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	398	564	1.9e-16	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	2.19e-41	399	605	1	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	5.65e-41	393	632	1	248	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04185	GT_2_like_b	1.07e-19	401	606	3	173	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	1.90e-16	399	515	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02526	GT2_RfbF_like	3.62e-14	401	606	3	204	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ97352.1	1.08e-234	2	702	321	1039
ADL33240.1	1.13e-233	5	722	7	738
AOZ97351.1	7.39e-162	5	741	7	663
AEN95288.1	9.59e-93	342	752	67	476
CBL07971.1	1.05e-81	342	752	67	477

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	3.29e-07	398	632	628	874	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003648_01412.