CAZyme Information: MGYG000003648_02605

Basic Information

• Species: NK4A136 sp002314855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; NK4A136; NK4A136 sp002314855
• CAZyme ID: MGYG000003648_02605
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		39190.64	4.7248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003648	3786163	MAG	Fiji	Oceania

• Gene Location: Start: 4041; End: 5063 Strand: +

Full Sequence      

MSLKDAYSNYFKMGVAVNPIDILLPPAKALIKREYNSITCENNMKPMFILDDEANLADPA
KYDLEPAVTFDNCKVFLDFAKKNNIPMRGHTLGWHNQTPLWFFHEGYDESKPLASRETMI
ARLQNYIKAVFEYINANYPNLIYAWDVFNEIVDEGSFRKSIWLDTIGEDFFIFAFEAARK
YSLPGTQLFYNDYETAEPWKRDFICEKVLAPLMERGLVDGMGMQSHLTMDHPDLELYKFA
LEKYGALGLIIHATELDIHNADPSDESMQALADRYAELFSIYVDAKKNGTANVECVTFWN
LLDEESWLTGFRKERSYPLLFWKGGQPKKAYQSVIDAASK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	2	337	9.3e-86	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	2.16e-109	3	336	1	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	3.33e-87	44	334	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	1.06e-70	32	340	55	343	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL33823.1	5.87e-155	1	338	1	338
CAA43712.1	8.34e-155	1	338	1	338
ACW01911.1	1.97e-93	3	338	10	349
ACP87283.1	1.97e-93	3	338	10	349
AHF26160.1	3.30e-89	2	338	9	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W5F_A	2.91e-63	3	336	184	526	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2W5F_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
5OFJ_A	4.45e-61	2	338	10	339	Crystalstructure of N-terminal domain of bifunctional CbXyn10C [Caldicellulosiruptor bescii DSM 6725]
2WYS_A	2.47e-60	3	336	184	526	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WYS_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
5OFK_A	3.49e-60	2	338	10	339	Crystalstructure of CbXyn10C variant E140Q/E248Q complexed with xyloheptaose [Caldicellulosiruptor bescii DSM 6725],5OFL_A Crystal structure of CbXyn10C variant E140Q/E248Q complexed with cellohexaose [Caldicellulosiruptor bescii DSM 6725]
7NL2_A	9.85e-60	2	340	11	343	ChainA, Beta-xylanase [Pseudothermotoga thermarum DSM 5069],7NL2_B Chain B, Beta-xylanase [Pseudothermotoga thermarum DSM 5069]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26223	1.67e-155	1	338	1	338	Endo-1,4-beta-xylanase B OS=Butyrivibrio fibrisolvens OX=831 GN=xynB PE=3 SV=1
P23557	1.03e-61	44	337	1	301	Putative endo-1,4-beta-xylanase OS=Caldicellulosiruptor saccharolyticus OX=44001 PE=3 SV=1
P51584	8.85e-61	3	336	195	537	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
P29126	2.40e-56	2	338	629	953	Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens OX=1265 GN=xynA PE=3 SV=1
O69231	1.64e-55	2	335	7	329	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003648_02605.