CAZyme Information: MGYG000003650_00658

Basic Information

• Species: UBA1786 sp900771425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA1786; UBA1786 sp900771425
• CAZyme ID: MGYG000003650_00658
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
985		111458.93	6.2407

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003650	2572020	MAG	Fiji	Oceania

• Gene Location: Start: 394; End: 3351 Strand: +

Full Sequence      

MKRLFLLSVFVVMVANMSAQHHINFNSDWYIGMPAKHVTLPRAWNEDEAFRNDIADLSDS
VVWYRKSFRLTTEQVRGKKVFVEFEGIRHAGEVYINDLPIGIHENGVMACGFDLTDYLRN
GKNMIEVKTDNDWNYHEKGSNSPYQWNNKNFNANYGGIPKNVWLHIVPEVYQTLPLYSNL
GTKGVYVYATDMNIAGKSATIHLESEVRNDSKSAASVTLTMSNEELNVSCSGEAVTLQPG
ETRVLTVECKADGIDWWTWGHGKLYDIISTLRNNTDGTTDEVVVTTGFRKTRFAEGKVWL
NDRVLMMKGYAQRTSNEWPGVGMSVPAWLSDYSNALMVKGGANLVRWMHVTPWKQDIESC
DRVGLIQAMPAGDAEKDVDGRRWEQRTELMRDAIIYNRNNPSILFYEGGNESISREHMNE
LKAIRDLYDPHGGRAIGSREMLDIDEAEYGGEMLYINKSAKHPMWAMEYCRDEGLRKNWD
EWSYPYHREGDGLLYKNQPSREWHHNQDQLAIEWVRRWYDYWRERPGTGTRVSSGGVKIV
FSDTNTHHRGSVNYRTSGATDAMRIEKDGYFANQVMWHGWVETDGEWQTHIIGHWNYESQ
SGQSQTDDTFRDFSKPVYVVSNSDSVQLFLNGRRLNVAPVHEYRFLYTFPDIKWESGTLE
AVSYDKEGREQSRHSITSVGEAKQLKLTAIHSPYPEVGESLPFIADGADMVLVQVEVVDA
QGRRCPLDDRMIHFTLTGPAEWRGGIATGRKDNYVLSKDLPVECGINRALIRSTCKAGKI
TIKASADGLPDAKITLRSVPAPSQKTFVAQNHAHTVTHFIKGEQPLTPSYVQTKTGVKII
SAKTDVNQDNARFAFDDNELSEWKGGHAITFTLERPAAVDDVCLKLAGWRNNRYPLEVYA
GDSLVWKGVTPTSLGYVHLEITAPVKSDTFTIRIANSSEPTQGNAKDTDVVPTELGGGQA
NELDRTTSRSTQSLRIVEAEFLQAL

Enzyme Prediction     

EC	3.2.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	19	530	1.8e-52	0.5837765957446809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.78e-24	24	445	29	440	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam18565	Glyco_hydro2_C5	4.96e-22	705	795	12	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10150	PRK10150	6.03e-17	47	430	57	431	beta-D-glucuronidase; Provisional
PRK10340	ebgA	2.62e-15	64	412	113	450	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	1.56e-11	23	168	34	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA48726.1	0.0	5	985	10	988
QUT69879.1	0.0	5	985	10	988
QUT42078.1	0.0	5	985	10	988
QQA07682.1	0.0	5	985	10	988
QMW86524.1	0.0	5	985	10	988

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	3.37e-127	24	800	39	806	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
7CWD_A	2.81e-38	36	804	34	807	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4CUC_A	1.55e-35	14	796	7	842	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]
4CU6_A	2.05e-35	14	796	7	842	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
6B6L_A	1.74e-32	36	796	35	775	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	1.51e-126	24	800	30	797	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	8.64e-28	18	796	40	846	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P77989	2.45e-26	23	786	6	725	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	4.99e-23	63	738	109	758	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	1.99e-19	38	687	82	733	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000481	0.998690	0.000251	0.000196	0.000183	0.000179

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003650_00658.