CAZyme Information: MGYG000003650_01147

Basic Information

• Species: UBA1786 sp900771425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA1786; UBA1786 sp900771425
• CAZyme ID: MGYG000003650_01147
• CAZy Family: GH98
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1048	MGYG000003650_60|CGC2	117105.82	6.41

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003650	2572020	MAG	Fiji	Oceania

• Gene Location: Start: 41807; End: 44953 Strand: +

Full Sequence      

MTMKLTKLYRFAFAMLLAICGTVAAQAQARRPIDSKHPLWLVHVDVWNKADPQKIIDLIP
DDIKPYVCLNLSLSCQYDVDQGVHKMPQNAVKTYKSWGTVCQANGMWFTCQPASGGKTHI
LDDDLETFEYFFKRFPNFLGWNYAEQFWGFDEGNKYSSSQPSRIALFAKLVEMSHKYGGF
LTVSFCGNIWSHPLNPVGMMKRNANLLNACKKYPESMLWLYKYTTSSCFYNNESVTFSPF
ISGLAANYGVRYDNCGWNGALDALLGENHGKKYPTSAGIGTVMEQTCVNGGAVWDGPELI
WTEDFQNLNNSTVNGYTRRNWGTFPGFKNIWIDMFRKIINGEMYIPTRQEVVEKTKIVVI
NDVSSGNDEQKYAAWGDLYDGLYKQSDPFNRGNGQWMDNFCYFKKTGRYAAIPVAIGLYD
DLAKSIPVQVKKSTYSSRWTTQTKKVTEFNKYYPEVSTGDLYVSRFKNQLVTYTPFTYMN
RKKTASAVIPLEYNTCESLSLTYGKLSSGCIREYADHIDFYLNNYRTDTTNIVLDEITIS
GATSEPTYKMSKRVNATSVTPTKTWDAETGTFTLSIQHMGPIDLTINCSGAQTERSTDLL
SDEPLTLDLPKQPEPYCGEVTIEAEDMDYKSIKSCVTDPYSWYPSVRGHAGNGFMDMGTN
TAGALCHHFKARTAGTYTIAVRYMSTAKAGVMVGAVNKSRKALKFEKTAANEWKRVTFEA
NMKEGDNELVITNTGGLNCYIDNVTYYPEGVPFELYAVNIRQAEHGTVTADVDSAAEGQL
ITLDVVPDEGYKLTGWTLVHGNVSISANNTFAMPDDNVTLAPVFTDVTAVYVLDYTGVGS
GMMPQGWQATQENSEVHSYPNSYSAGARTFTGFTGYQGAALYWRNEFAEYGRQSAYPLKL
TAGKYRLTYASAAWKGTPRYKIQILDASSNVIAEGTSTLASPNVNGSTTGNISSARKYEL
EFDIESDGKYIIRFQNTSATSSGFTEFLIACCQLNSVPLVDAITVTEADNTPDEEAYYDI
NGQRLNSPRRGINIVRTADGHSRKVLFR

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH98	27	342	4.5e-86	0.9877675840978594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08306	Glyco_hydro_98M	1.18e-92	27	341	5	326	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
pfam08307	Glyco_hydro_98C	2.70e-11	348	587	1	268	Glycosyl hydrolase family 98 C-terminal domain. This putative domain is found at the C-terminus of glycosyl hydrolase family 98 proteins. This domain is not expected to form part of the catalytic activity.
pfam18998	Flg_new_2	3.18e-11	756	828	1	74	Divergent InlB B-repeat domain. This family of domains are found in bacterial cell surface proteins. They are often found in tandem array. This domain is closely related to pfam09479.
cd04083	CBM35_Lmo2446-like	8.80e-07	648	746	22	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd02795	CBM6-CBM35-CBM36_like	2.99e-05	621	735	1	112	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29515.1	0.0	16	1046	9	1033
AOZ99817.1	1.16e-179	11	746	16	741
QUT78600.1	9.36e-173	30	744	228	934
QUT26887.1	9.36e-173	30	744	228	934
QRQ55178.1	7.21e-172	30	744	228	934

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WMF_A	7.14e-13	26	586	26	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in its native form. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007914	0.881441	0.108267	0.001628	0.000392	0.000353

TMHMM  Annotations     

start	end
7	29