CAZyme Information: MGYG000003650_01361

Basic Information

• Species: UBA1786 sp900771425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA1786; UBA1786 sp900771425
• CAZyme ID: MGYG000003650_01361
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
893		98278.34	4.8678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003650	2572020	MAG	Fiji	Oceania

• Gene Location: Start: 8526; End: 11207 Strand: -

Full Sequence      

MTKKLHLALMMAAGMFATTAHAQLIDNPYKFLGNITTRYQMDTDGFLYRNLWNQVTPENE
TKWASIEGNRGQFNFGGADNAYNYAKKWNLGFKFHCLIWGAQYPSWLDNLSTAQQYTEIV
KWFDAVKAHYPDLKMIDVVNEAVPGHQPARYKDALGGDGQTGYDWIIKAFEMAHERWPDA
ILIYNDYNTFQWQRTEFINLVKTLINAGAPIDAYGCQSHDLTDMNVSSFKSAMTEIQNAL
KIPMYSTEYDIGTTDDALQLQRYKEQIPVMWEADYCAGITLWGFIYGATWTTDGNSGIIR
NGKDRPAMTWLREYMKSDAAKNAKSPFEKGYIKEASIYMKAAPTVISIGDSANIVINARL
KTKTIQDIKVYVNGSLYTTLDGSEAVNDVFTVPYVPAKTGNYTLKAIVTATDGTTFQRPS
AFTVHKQRTIFRGGATLPGVLQAENFDGGGEGFTFHDSDTKNEGVSFRNDGGGVDIVSGN
GGYAIGYTNSGEWLEYTVDVQEEGYYGYKAWASSGTTNSGFSLSLADNGVLTTLIEPVTV
PCITQNSWDKYSVIEGKCVAKLPAGKHVLRLAITGSSCNIDRIEFTNLHLNPDLKIGIKV
EPAMLTIGETATITVNNKTDIPVDHVDIFADDELLEVTGAGPYTATYTSNATGLVTIKAV
AVDTNGNSSDTYSTSLIITEPRSPYLGTAWTLPGLIEAENFDAGGEGLTFHDTDYEDEGK
NIYRNDNAGLDIIEDNGGYVVSNTAAGEWMEYSVNIVDPGTYTYDIVGKAVSGNPQLTIA
LADDGKITALTSSTNKIKISNTKAYETSHGNLLRKLKEGNHIIRITVNSGNCCIDNIKFT
CVLNTAIDEVNDNVKSDVIYDLQGRRITDGKSLIKEGALKGIYIINGKKRLLY

Enzyme Prediction     

EC	3.2.1.8	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	31	312	1.6e-72	0.9504950495049505
CBM6	443	586	4.1e-32	0.9855072463768116
CBM6	698	840	1.9e-19	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	2.09e-72	62	311	2	263	Glycosyl hydrolase family 10.
COG3693	XynA	1.42e-62	27	317	31	343	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
pfam00331	Glyco_hydro_10	3.00e-57	52	313	35	310	Glycosyl hydrolase family 10.
cd04080	CBM6_cellulase-like	2.72e-36	437	586	1	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
cd04080	CBM6_cellulase-like	5.68e-25	692	840	1	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADX05708.1	2.77e-248	18	889	28	894
ADX05720.1	3.94e-135	14	636	17	564
ADL25544.1	1.60e-131	24	616	27	540
ACX75387.1	2.25e-131	24	616	27	540
AAG36763.1	1.67e-116	24	616	27	541

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PMY_A	1.54e-53	22	315	1	299	Crystalstructure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylose [Xanthomonas citri pv. citri str. 306],4PMY_B Crystal structure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylose [Xanthomonas citri pv. citri str. 306],4PMZ_A Crystal structure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylobiose [Xanthomonas citri pv. citri str. 306],4PMZ_B Crystal structure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylobiose [Xanthomonas citri pv. citri str. 306]
4PN2_A	1.63e-53	22	315	2	300	Crystalstructure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylotriose [Xanthomonas citri pv. citri str. 306],4PN2_B Crystal structure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylotriose [Xanthomonas citri pv. citri str. 306]
4PMX_A	1.68e-53	22	315	2	300	Crystalstructure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri in the native form [Xanthomonas citri pv. citri str. 306]
1E0V_A	5.80e-30	52	320	38	305	Xylanase10A from Sreptomyces lividans. cellobiosyl-enzyme intermediate at 1.7 A [Streptomyces lividans]
1E0W_A	1.06e-29	52	307	38	291	Xylanase10A from Sreptomyces lividans. native structure at 1.2 angstrom resolution [Streptomyces lividans],1E0X_A Xylanase 10a From Sreptomyces Lividans. Xylobiosyl-Enzyme Intermediate At 1.65 A [Streptomyces lividans],1E0X_B Xylanase 10a From Sreptomyces Lividans. Xylobiosyl-Enzyme Intermediate At 1.65 A [Streptomyces lividans],1OD8_A Xylanase Xyn10A from Streptomyces lividans in complex with xylobio-isofagomine lactam [Streptomyces lividans],1V0K_A Xylanase Xyn10A from Streptomyces lividans in complex with xylobio-deoxynojirimycin at pH 5.8 [Streptomyces lividans],1V0L_A Xylanase Xyn10A from Streptomyces lividans in complex with xylobio-isofagomine at pH 5.8 [Streptomyces lividans],1V0M_A Xylanase Xyn10a from Streptomyces lividans in complex with xylobio-deoxynojirimycin at pH 7.5 [Streptomyces lividans],1V0N_A Xylanase Xyn10a from Streptomyces lividans in complex with xylobio-isofagomine at pH 7.5 [Streptomyces lividans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23030	3.67e-75	30	311	323	592	Endo-1,4-beta-xylanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=xynB PE=1 SV=2
P26514	1.98e-28	52	333	79	357	Endo-1,4-beta-xylanase A OS=Streptomyces lividans OX=1916 GN=xlnA PE=1 SV=2
O94163	8.75e-28	54	290	66	301	Endo-1,4-beta-xylanase F1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xynF1 PE=1 SV=1
Q0H904	2.33e-26	47	306	59	314	Endo-1,4-beta-xylanase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xlnC PE=2 SV=2
A2QFV7	1.48e-25	30	309	41	321	Probable endo-1,4-beta-xylanase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xlnC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000526	0.998136	0.000375	0.000326	0.000307	0.000282

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003650_01361.