CAZyme Information: MGYG000003650_01989

Basic Information

• Species: UBA1786 sp900771425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA1786; UBA1786 sp900771425
• CAZyme ID: MGYG000003650_01989
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
661		75697.83	6.3331

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003650	2572020	MAG	Fiji	Oceania

• Gene Location: Start: 12941; End: 14926 Strand: -

Full Sequence      

MKKILLILWLSLPIGSISAQESKEGVQDIWNLPPLPIEQGDYTTAWDNLSRRYNVPAWWR
EAKLGAWSHWDPQSMAEDGDWYARSIYIEGHPQARYHREHYGHPSEYGYKELCRDWKTDR
WNPDELMQLYRKMGARYFLAMGNHHDNFDCWDSKYQPWNSVNVGPNQDIVGIWAETARRY
DMPFGIGFHNTPARTWGQFMTVRYTSDKNGDKKGVPYDAMLTLEDGYKPNADGTEKWWKG
MDPQDLYGPEHHNGRNSLDSPFANQFMWRVDDAIRRYQPDMIYFDDHAGDSQEDLGINMG
LGRLTPQIIANFYNIASKRKSGNREVVATFKGVGGRYNSFQRNPEMVNIVDRSLVKSTEL
YTEDDIMAFPFQTEVSLQEWHYQQGARYRSASEIVTRLMQNVSRNGCLLLNITQHGRGDI
DPEARQICLDFGRWIEINSEAIYSARPFDVWGNEHVIYTRQGGYIYATILPPATEDIVLQ
PLSTQSPSVGKILKVEMLENGRSIPFKQSAEGLTVQIKQSVTQGITNQELAQGFKVLRIT
HDKTWFNDDDPGVQTYGWNRTTGKGTGDFNNDISFSDQVGDRWSVPFSGKRISIIAPTGE
HEGRMQIVTDGKACGEVAFHKGTERKAQQVVFTSNKLKKGKHTLELVNLEGTIAVDALKI
E

Enzyme Prediction     

No EC number prediction in MGYG000003650_01989.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	38	443	1.8e-76	0.9277456647398844

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	1.84e-80	39	440	3	333	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	2.47e-68	36	482	1	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	9.26e-56	69	536	1	429	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam16757	Fucosidase_C	4.19e-04	453	519	6	73	Alpha-L-fucosidase C-terminal domain. The C-terminal domain of Structure 1hl8 is constructed of eight anti-parallel-strands packed into two-sheets of five and three strands, respectively, forming a two-layer-sandwich containing a Greek key motif.
cd04086	CBM35_mannanase-like	0.003	577	661	32	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXC15853.1	1.27e-123	37	520	33	527
QDO68463.1	2.44e-111	1	517	1	530
QUT88746.1	6.80e-111	1	525	1	538
ALJ60261.1	6.80e-111	1	525	1	538
QEM02478.1	2.28e-108	40	519	37	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LJJ_A	4.31e-53	48	520	49	497	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
7LNP_A	2.12e-52	48	520	49	497	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_C Chain C, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_D Chain D, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_E Chain E, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
4NI3_A	9.27e-40	40	452	5	383	ChainA, Alpha-fucosidase GH29 [Fusarium graminearum],4NI3_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum]
2WSP_A	7.60e-25	42	523	8	436	Thermotogamaritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8],2WSP_B Thermotoga maritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8]
1ODU_A	1.02e-24	42	523	8	436	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P04066	2.35e-27	42	498	37	424	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4
Q60HF8	4.34e-27	8	519	15	448	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1
P17164	2.39e-26	42	539	33	461	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
P48300	6.28e-25	42	519	37	445	Tissue alpha-L-fucosidase OS=Canis lupus familiaris OX=9615 GN=FUCA1 PE=2 SV=1
Q2KIM0	2.80e-24	42	519	40	448	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000377	0.998956	0.000177	0.000167	0.000151	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003650_01989.