CAZyme Information: MGYG000003651_00386

Basic Information

• Species: RF16 sp900767595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; RF16; RF16 sp900767595
• CAZyme ID: MGYG000003651_00386
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
696		78859.16	6.2811

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003651	2005832	MAG	Fiji	Oceania

• Gene Location: Start: 28317; End: 30407 Strand: -

Full Sequence      

MKNIRLFTLVLLSTIHCSLSTINAQDPWRIDVPQPLQGDYYGITSANGQIGLVSSRTPLE
VDKLVIGGLYDLYAKARTDNFFPNINPLDIELRVNGDNVSRSKIENYTQSFDLKHAAIQG
QYDFRDQLHVDYRIMALRQLPFGYMMDITITANSDIHLRVINQHRAPEALRNPEPYFTTI
DNKANPLLKTSYPHYTFMTTMAKSPTGRFDVGACTAFLFPDSEDGGTMLPIIHRDDRGVG
RHTQEFELPLQQGQTFHFCLVGNSMGSNFVPDVRNEIERLTIYMFLEGYDRLIARHNRAW
DELWQSDILVEGDAQAQQDIHSMLYHLYAFNREGSGLSCSPMGLSGLGYNGHSFWDADTW
MFPALAVLHPETAVEMLNRRYDLLQGAIQKAYMHGFKGAWFPWQTSYTGQEEVAPNNVYP
STECHITGDAAIACWQYYQLTQDKDWLLEKGWPILSLTADYWTSRVDWDENGNAHFISVI
GADEWSCNVHGGKQIDDNAYTIGVARTNLDYAARAAKVLGKKAKPEWAKTRNALHYRYLD
NGVIAVNATYHGEVTKQADVDLLAFPLHEVTDPAQIRRDLEYYISKVPDKQTPAMSKSIY
ATLFSRLGDYDKALYYFRDSYLPNLNPPFRVIAEFNGGTNPYFITGAGGTLQSLLFGFAG
LDITDKGLVQVRKAKLPTGWTKLTIRRIGHPDLVIQ

Enzyme Prediction     

No EC number prediction in MGYG000003651_00386.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	323	665	7.1e-85	0.989247311827957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	2.34e-83	26	683	9	718	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	1.79e-52	324	665	4	384	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	8.99e-33	185	686	187	710	maltose phosphorylase; Provisional
pfam17389	Bac_rhamnosid6H	3.23e-04	393	587	61	255	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL39214.1	1.43e-254	22	689	21	676
QMI82226.1	2.11e-226	11	689	5	666
AFD05259.1	1.67e-224	10	689	19	680
QEC65248.1	1.63e-223	4	692	6	670
AMR32015.1	4.95e-223	5	689	3	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	1.32e-213	25	689	21	668	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	9.79e-38	243	683	227	714	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	1.28e-20	233	688	215	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	2.24e-20	233	688	215	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	3.43e-56	290	690	252	652	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
F1NZI4	4.04e-56	285	668	225	619	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
A0JMP0	1.39e-49	149	668	47	567	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Danio rerio OX=7955 GN=pgghg PE=2 SV=1
Q8BP56	1.02e-48	292	668	226	608	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Mus musculus OX=10090 GN=Pgghg PE=1 SV=1
Q32M88	1.24e-48	280	668	215	609	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Homo sapiens OX=9606 GN=PGGHG PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000627	0.712660	0.285945	0.000263	0.000256	0.000231

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003651_00386.