CAZyme Information: MGYG000003651_00408

Basic Information

• Species: RF16 sp900767595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; RF16; RF16 sp900767595
• CAZyme ID: MGYG000003651_00408
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase BoGH31A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729	MGYG000003651_38|CGC1	85228.51	4.8815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003651	2005832	MAG	Fiji	Oceania

• Gene Location: Start: 15729; End: 17918 Strand: +

Full Sequence      

MTAYVLRTTGQVWVNRYDGKPLLQEAANSPRFTPYECTQPLPLNSTLSTTLNSTLSTLNY
TGWTYAVTFDNLYNEEGLFGLGQHQSDEWNWKGRDEELYQYNTKVSLPIIFSTEGYGLMF
DTYSLCRWGNPEPYQPLEELFDVDTVALPYSSTPLLPSSPKTIVYEGTLTPRATGEYRFL
HYYSGYQQLFIDGQPLSPTIWRTAWNPNERKYRYYMEKGRTYRIRLTWQPDGDVAYCSLT
AHAPETTEQHQQLRFWSEMNPNLDYYVFAGENMDSLIHSYRTLTGKATLMPDWVLGYWQS
RERYKTQEEIIDALRGFRSRNLPIDNIVMDWNYWEPSQWGAFTFEESRFPDPQAMIDTIH
ALGAHIMISCWPKYYPFTDHYQEMLAKGWLYPQSIRDSLIDWLGFPYAFYDAYNPKAGRL
FFEQLWEHLGTMGIDAWWMDASEPNIKDCTPIDYRKALCGPTYLGSSDEYFNAYALVNAQ
SIYEGLQRKGVQDIFQLTRNGFLGQQRYSTATWSGDIGTRWEDMKAQITAGQNFSVSGLP
WWSQDIGGFSVENRYAAAQYAFEATGKENADLKEWRELNVRWHQWGVFTPIYRSHGQFPY
REPWNIAPEGHPAYEAIRQCLNERYKLMPYLKELNRRVSEEDYTIMRPLAMDYPSDPKAI
ACGWQYMFGPDIMVCPVYTYGAREWSVYFPAGTWYDYYTGELISNGNETRIVPAPYDHSP
IFLRNKSQL

Enzyme Prediction     

EC	3.2.1.177

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	265	727	3.9e-134	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01055	Glyco_hydro_31	8.99e-153	266	724	1	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06591	GH31_xylosidase_XylS	4.37e-145	285	624	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
COG1501	YicI	5.43e-129	250	729	221	670	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06604	GH31_glucosidase_II_MalA	1.03e-57	285	631	1	328	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
cd06598	GH31_transferase_CtsZ	1.22e-57	285	631	1	326	CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z)-like. CtsZ is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY. CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsY belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ47674.1	2.09e-278	3	724	101	836
SCV07072.1	2.23e-278	3	724	103	838
QRQ54579.1	2.23e-278	3	724	103	838
QUT79265.1	1.19e-277	3	724	101	836
QDM10329.1	1.19e-277	3	724	101	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JOU_A	8.41e-280	3	724	104	839	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
2XVG_A	3.74e-182	71	724	175	869	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
7KMP_A	4.18e-179	1	724	132	860	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
6DRU_A	1.35e-55	254	722	207	704	Xylosidasefrom Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
5F7C_A	3.28e-46	263	727	280	713	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT0	4.46e-279	3	724	103	838	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q9P999	3.47e-103	249	729	176	622	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q01336	9.75e-60	257	603	208	527	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
A2QTU5	9.32e-55	254	722	225	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
Q9F234	1.07e-53	263	729	230	674	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.994133	0.005692	0.000100	0.000027	0.000012	0.000043

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003651_00408.