CAZyme Information: MGYG000003654_00217

Basic Information

• Species: F082 sp900542475
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; F082; F082; F082 sp900542475
• CAZyme ID: MGYG000003654_00217
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469		54676.88	5.8275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003654	2069772	MAG	Peru	South America

• Gene Location: Start: 2759; End: 4168 Strand: +

Full Sequence      

MNRPYFSGVSVPVFSLRSDESCGIGEFLDLKKLADWCVATGLKLIQILPVNDTTTDGGWN
DSYPYKSISTKALHPIYLNVERVGLLDDENDRRRFQEIKKTLNAKEFVDYPEVFKAKMDY
LRKIHLQKQDEKPDFHGFLQMHCEAQLAEAVDYLHERGVMLKGDLPIGVSRDSDDVRQHP
HLFNLDMDAGAPPDAFAAQGQNWGFPTYNWDAMEDDGFQWWRERVAWFKKYFDALRIDHI
LGFFRIWEIPKGSQNATCGHYSPENPRLWEAEGRKRLSRIFDLPHADTRQGSALLICGED
LGMVAPCVPGVMRELGILSLEVQRMPKQSGRQFSDPRENPYLSVDTTGTHDMPTIRGWWE
ENRNVSAHFYHEMLHHTDNPPYFCEPYICKEIIEQHLNSNSQWVIIPIQDYIAMDGDFRW
DKTWEETINNPADPNWKWKYRMHQSLETLLGNEKLTLTLKNMIKTYNRL

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	127	466	2e-102	0.645748987854251

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02446	Glyco_hydro_77	4.54e-165	11	445	1	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02950	PLN02950	1.11e-137	7	459	262	909	4-alpha-glucanotransferase
PLN03236	PLN03236	5.31e-111	7	469	62	742	4-alpha-glucanotransferase; Provisional
COG1640	MalQ	3.54e-99	2	468	9	514	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14508	PRK14508	3.22e-98	1	469	1	497	4-alpha-glucanotransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE19176.1	1.30e-137	7	468	246	902
BCI61702.1	2.59e-133	7	468	237	891
QNP53186.1	1.41e-132	7	462	160	812
BBL00124.1	3.66e-130	7	468	225	865
BBL08204.1	4.01e-129	7	468	225	865

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	1.53e-41	7	441	24	484	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
1X1N_A	7.29e-41	19	469	88	524	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	1.41e-40	19	469	140	576	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
5CPQ_A	4.48e-37	19	469	128	564	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
6M6T_A	2.89e-36	1	468	1	496	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69Q02	4.70e-105	7	468	265	921	4-alpha-glucanotransferase DPE2 OS=Oryza sativa subsp. japonica OX=39947 GN=DPE2 PE=2 SV=1
Q8RXD9	3.38e-101	7	468	271	927	4-alpha-glucanotransferase DPE2 OS=Arabidopsis thaliana OX=3702 GN=DPE2 PE=1 SV=1
Q9Z8L2	1.99e-65	8	454	26	514	4-alpha-glucanotransferase OS=Chlamydia pneumoniae OX=83558 GN=malQ PE=3 SV=1
O84089	1.09e-64	8	455	30	519	4-alpha-glucanotransferase OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=malQ PE=3 SV=1
Q9PKU9	1.67e-62	8	462	30	526	4-alpha-glucanotransferase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999852	0.000179	0.000001	0.000001	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003654_00217.