CAZyme Information: MGYG000003654_00640

Basic Information

• Species: F082 sp900542475
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; F082; F082; F082 sp900542475
• CAZyme ID: MGYG000003654_00640
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000003654_17|CGC1	42711.33	10.3024

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003654	2069772	MAG	Peru	South America

• Gene Location: Start: 2728; End: 3852 Strand: -

Full Sequence      

MKYYIIAGEASGDLHGSNLVASIRQKDPNAKIRAWGGEKMRRNGANVVKNYHDLAFMGFV
EVLMNLNTILKNFNICKKDIAKFNPDAIILIDYPGFNLKIAKWAKKKGFKVFYYISPQVW
AWKRRRVRTIKKVVDKMLCILPFEKKFYDNYNVDSQFVGHPLLDEITKIGPVDKGRFYKA
NRLNPRKEIIALLPGSRKQEVGKMLPVMLEVVKMFTSYQFVVACAPSLPIGYYKKIIGEK
SNVRLVLNRTYQLLQLSSAAIVTSGTATLETALLDVPEVVCYKANKISYIIARHLAKVNY
ICLVNLIMDRLVVKELIQNDMTADNIRDEIQSLLNNSKRQKKLLDDYEELKFVLGNAGAS
DRAARTIISYIKKN

Enzyme Prediction     

No EC number prediction in MGYG000003654_00640.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	351	9.2e-128	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.04e-134	1	374	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.44e-118	1	368	2	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.14e-91	4	364	2	368	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.99e-88	5	370	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.74e-69	52	373	46	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASK30782.1	2.89e-151	1	368	1	365
AZA52255.1	2.72e-149	1	368	1	365
QIY92167.1	5.67e-149	1	371	1	368
AKK72128.1	8.04e-149	1	371	1	368
AZB09845.1	1.10e-148	1	369	1	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	7.44e-51	5	368	11	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.04e-50	5	368	11	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	3.66e-87	5	374	8	381	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	2.39e-79	2	373	8	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B6J161	1.06e-78	5	371	8	374	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	1.50e-78	5	371	8	374	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q83DS5	2.11e-78	5	371	8	374	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000020	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003654_00640.