CAZyme Information: MGYG000003656_00496

Basic Information

• Species: UBA1417 sp003531055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1417; UBA1417 sp003531055
• CAZyme ID: MGYG000003656_00496
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000003656_8|CGC2	41243.37	4.796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003656	2385409	MAG	United States	North America

• Gene Location: Start: 103093; End: 104202 Strand: -

Full Sequence      

MSEVKRYTLPEVPHLVHGRTNGSLTPLTLFWTAAGLELNVRGSELWVEFTADWDIHEPWY
SFMVNGEFFSRRMAQKGTERVCVFRGMDPEKVKNVRIFKDTQAMNADPESVLQINAVETD
GEFLPVPERNLKIEFIGDSITSGEGDIGAKAETDWISMFFSAENNYAVMVSRALNADIRV
SSQSGWGVCCGWNNDPNSAIPPIYGQLCGLLSGEKNIALCAKEPYDFTKWQPNYVFINLG
TNDCGAFSQPAWTNETTGETFQNRRTEDGKLNPEDEARFVHGATAFLKQLRGYYPNARLV
WIYGMLGLELAPALQKAIDDYKAETGDANAEFLSLTDDLKNRGCRDHPGVGAHRTAANEL
IAYIKKQNA

Enzyme Prediction     

No EC number prediction in MGYG000003656_00496.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	132	364	2.6e-56	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	2.16e-32	132	365	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
COG2755	TesA	1.38e-05	132	368	10	212	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
cd00229	SGNH_hydrolase	3.50e-05	133	363	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam00657	Lipase_GDSL	7.33e-05	133	360	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSF44991.1	4.38e-139	3	366	6	371
AGA56307.1	5.90e-139	3	365	21	385
ASR46179.1	3.84e-135	4	366	7	371
AOK89582.1	5.44e-135	4	366	7	371
QOS81840.1	7.46e-135	3	366	6	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3U37_A	3.56e-109	18	367	53	403	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
4DEV_A	1.15e-107	18	367	53	403	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
2WAO_A	1.11e-17	31	367	29	330	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	2.77e-17	31	367	29	330	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2W9X_A	2.14e-11	124	367	136	356	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	2.10e-16	31	367	510	811	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PDE5	1.14e-10	124	367	136	356	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1
B3PIB0	4.94e-09	119	366	139	354	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003656_00496.