CAZyme Information: MGYG000003656_02074

Basic Information

• Species: UBA1417 sp003531055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1417; UBA1417 sp003531055
• CAZyme ID: MGYG000003656_02074
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
891	MGYG000003656_21|CGC1	102629.22	5.1522

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003656	2385409	MAG	United States	North America

• Gene Location: Start: 44418; End: 47093 Strand: +

Full Sequence      

MSKLSLAGAWKLRGEFMDVTAERYNEVLRKMDAAPVRATLPAFLKLEDLSEEEQAEFLKD
PNPHFHVMTDKANHAFPSKYGFIPMTVPGDVTTALIESGIAEEPFLKENTKKNQWIKDLS
WWLVRDFDVTEEMLNEDIVRLNIEMLDFNADIIVNGMPAAHHENAFCAFSEDIKRFLHVG
KNQLVIRLTSGMELHYPRDAVSFYCASENAICDQRVYTRKPQFTYGWDWCQPVPTCGIGR
SIEIEAFSGAQVIASRVDTLKLDGDDAEVEFHFEIEKSDMVSSAECELTYTLEFEGKTVY
TGKKTLMLVGGVNFAEERVTIKNAKLWWPNGYGAQNLYTFKACCVTKGILHEMQPKKIGI
RTLELDTSKLEDGSRNFFFKVNGVRIFCKGGNWVPTDSLYLRTPKESYETLVREGAAAHF
TMFRMWGGGTYEPDCFYEYCSEYGILLMHDFMYACAFYPDHKNDFLFEAEREAEYQTKRL
AHYPCMAIWTGNNEIAESYTDWFPAPIKPERFYGEKIFNYIQPRAVHRNSPLVPYMPSSP
YFGDRANESEQGDVHAWSFFGRHPKTKFKFVYELEAFDRIPARFSSEYGFFGAQMESTVR
RYLDGTEMRFDNPIWKHHGEFDRKRSNIDGAIDRHLTEFKTLDEHGYLLYSGIMQGLLYA
ELAEAMRRKPYGAGDLIWMYNDCWPETGWTIIDYYLTRKISFYFLKRAFATKKLIIRACE
GGAEVTVINETPEAFTADIHCGYMIFTGETDSLCTKALKVAPHSMQQFHISVCNDLKHGF
FFASAEGFDTADSLRAYYRDYVFPESDAKIEKVEQDGNDLLVTIRASVYTPFAYLMTSDD
RVHYDDNYVTLYPNEPKTLRVENCTETPVLHVAAPAPSEETKKASYTDSWF

Enzyme Prediction     

No EC number prediction in MGYG000003656_02074.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	82	772	2.5e-72	0.663563829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.48e-50	50	718	4	637	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	4.63e-11	256	361	7	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	1.28e-07	807	862	1	57	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10150	PRK10150	1.04e-04	122	380	68	295	beta-D-glucuronidase; Provisional
pfam18368	Ig_GlcNase	0.001	842	862	65	85	Exo-beta-D-glucosaminidase Ig-fold domain. This domain can be found in 2 glycoside hydrolase subfamily of beta-glucosaminidases (EC:3.2.1.165) such as CsxA, from Amycolatopsis orientalis that has exo-beta-D-glucosaminidase (exo-chitosanase) activity. It has an immunoglobulin-like topology.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97926.1	5.59e-302	1	864	1	839
BBI35730.1	5.40e-175	87	861	38	824
AEF81825.1	2.20e-168	86	863	37	818
QGQ95120.1	4.52e-168	82	863	33	828
QTH41537.1	6.72e-157	81	862	31	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.87e-111	87	860	48	809	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.03e-94	82	869	25	829	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.08e-94	82	869	27	831	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.10e-94	82	869	27	831	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.81e-94	82	869	25	829	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	1.76e-75	86	707	31	651	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q2TXB7	6.79e-69	102	707	47	651	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	1.27e-68	102	707	47	651	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
I2C092	7.04e-68	82	861	25	838	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q4WAH4	8.39e-68	87	707	32	651	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003656_02074.