CAZyme Information: MGYG000003658_00162

Basic Information

• Species: CAG-110 sp900546915
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900546915
• CAZyme ID: MGYG000003658_00162
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640		74743.74	6.5498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003658	2415548	MAG	United States	North America

• Gene Location: Start: 57098; End: 59020 Strand: -

Full Sequence      

MDKKTKELLKDFHSGTCIRAYDLLGCHRITRRGKAGYVFRVWAPNAKQVCVVGEFNFWNP
EDLPMERLDDSVWEVFTTRGYEGCPYKYYITRPDGSTVYKADPYATRAACLPDTSSLICT
EDKHNWGDGKWMRDFPLRSPLTAPMNIYEMHLGSWRRKEDGSPFTYAELAEPLTAYLKDM
GYTHVEFMPLSEYPYDPSWGYQVTGYYAPTFRYGEPEGLRVLVDTLHRAGIGVILDWVPA
HFPKDEQGLYEFDGTCCYELSDPTMNEHPDWTTRIFDFGKPEVKCFLVSNAVYWLEKFHI
DGVRVDAVSSMLYLDYGRTSYKPNRFGGRENLEAMELLRSVNRAAFRTRPNSLMVAEEST
AFPMITKPDFDGGLGFLFKWNMGWMNDTIQYMQTDPIYRKYKHNNLTFSMTYAFSENFIL
PLSHDEVVHGKASLINKMPGEYDQKFSNLRAMYAYMIAHPGKKLSFMGNEFAQFIEWRYD
EQLDWLLLDYDRHRQMQSFVRDLNHFYLSHPQFWQNEQDWNGFQWIQPDAGDDNLLAFRR
IDRRNREVLVVCNFCPVERRHYRLGVPRRGIYKPVLCSDDPKYGGTGAEIRPAVSERVSF
RDYKLSACFDIPPMSATFYVRENPPKKSAQPKEETAKPAD

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	176	473	2.6e-148	0.9933554817275747
CBM48	24	108	2.4e-18	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	0.0	12	622	108	724	1,4-alpha-glucan branching protein GlgB.
PRK14705	PRK14705	0.0	19	620	618	1221	glycogen branching enzyme; Provisional
PRK12313	PRK12313	0.0	5	622	8	628	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	9	634	12	636	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	12	619	14	626	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX62812.1	5.56e-265	12	619	14	626
CBL01646.1	3.54e-255	12	639	20	650
AXB29737.1	7.30e-254	12	639	20	650
QNK41917.1	1.54e-251	9	621	14	629
CBK98932.1	1.96e-251	12	636	20	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JOY_A	8.04e-212	5	587	5	583	TheX-ray Crystallographic Structure of Branching Enzyme from Rhodothermus obamensis STB05 [Rhodothermus marinus]
1M7X_A	1.61e-197	15	622	5	615	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	1.10e-196	16	622	1	610	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
3K1D_A	1.32e-193	12	587	109	686	Crystalstructure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV [Mycobacterium tuberculosis H37Rv]
5GQW_A	4.98e-192	5	615	130	767	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	1.89e-222	12	619	14	625	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q0SWZ1	1.03e-217	12	621	40	656	1,4-alpha-glucan branching enzyme GlgB 1 OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=glgB1 PE=3 SV=1
Q8XPA2	4.16e-217	12	621	40	656	1,4-alpha-glucan branching enzyme GlgB 1 OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=glgB1 PE=3 SV=1
Q1AZ86	3.35e-215	12	624	107	721	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
O66936	1.40e-214	12	622	15	629	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003658_00162.