CAZyme Information: MGYG000003659_01029

Basic Information

• Species: CAG-594 sp900771805
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-594; CAG-594 sp900771805
• CAZyme ID: MGYG000003659_01029
• CAZy Family: GT4
• CAZyme Description: Processive diacylglycerol alpha-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		38324.9	9.8952

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003659	1207824	MAG	Peru	South America

• Gene Location: Start: 46800; End: 47798 Strand: -

Full Sequence      

MKVLLYTEGLKTIGKSGLGKAIKHQMKALDKVGVSYTLNPKENYDILHINTYFPKSYFFA
KKAKKNGKKIVYHAHSTEEDYKNGFIFSSITSKLFKKWLIKCYSLGDVIVTPTPYSKKLL
KGYKGLEKKKIYAVSNGIELDFFKKDKTLREKFRKRYNYKDTDKVIIGIGLYIKRKGIID
FVELAKRCPEYKFIWFGYSPLIAAGRKVRKAVNTKLDNLIFAGYVEQDIIKEAMNGCDLY
LFPTLEETEGIPIIEACACSCDSIIRDIPIFDDWLYDGINVYKAKDVDEFERKIKLFLNN
KIPSVSKNAYDVAKQRDISKIGEELKKIYESL

Enzyme Prediction     

No EC number prediction in MGYG000003659_01029.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	159	301	5.4e-17	0.91875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	2.58e-28	27	330	69	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03817	GT4_UGDG-like	5.85e-24	70	332	111	372	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
COG0438	RfaB	3.13e-23	43	332	83	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03798	GT4_WlbH-like	3.31e-16	91	329	136	373	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
cd04951	GT4_WbdM_like	8.99e-15	124	329	149	358	LPS/UnPP-GlcNAc-Gal a-1,4-glucosyltransferase WbdM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after WbdM in Escherichia coli. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH47059.1	5.19e-132	1	329	1	327
CBL33526.1	2.80e-130	1	329	1	326
CBK95486.1	2.80e-130	1	329	1	326
QQB61989.1	3.14e-127	1	332	1	329
QQN56664.1	1.19e-124	1	332	1	329

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8KQL6	3.58e-80	1	332	1	327	Processive diacylglycerol alpha-glucosyltransferase OS=Acholeplasma laidlawii OX=2148 GN=dgs PE=1 SV=1
Q8DPV9	4.93e-15	14	271	48	307	Alpha-galactosylglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=cpoA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003659_01029.