CAZyme Information: MGYG000003661_00679

Basic Information

• Species: Acetatifactor sp900554205
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900554205
• CAZyme ID: MGYG000003661_00679
• CAZy Family: GH66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	MGYG000003661_53|CGC1	62379.61	4.8511

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003661	3177635	MAG	Peru	South America

• Gene Location: Start: 5030; End: 6679 Strand: +

Full Sequence      

MKNSYIECYPDAAQYKEDQAVSIVIDATPGKQPHSLQIRVSSIDGYIQEKYVETEGKQVV
VLEKFPRGMYGVDLFEDGKAVAHTAFDVTGETERVVRYGFLTDFGTEETTDEDIEFINKM
HLTAIQFYDWMYRHDDLVYDGEEYDNPLGISISNHVLRHKIDLCKKHHIRPFAYGAVYAA
SKGFYEKHREWAMYTQEKEPITFADWLVFMNINRECGWSGHILEQFARAVKTLGFQGIHM
DTYGYPKKAWTLDGEPINLEKDFPELINASAGVVQREDPEAGVIFNAVNDWPVESVAGSA
QDSIYIEVWPPHDTYLDLMQLISKARSLSGGKQVILAAYMHPFAEKNNPESAEKSFLLTF
AVIHASGGYQLVLGENKGILCDSYYNKYATLRDEFLPKVKAYSDFVVRYGELLFAKAITD
ISMTATGGINEDILFSSEQTGFSVKPEADKVWTKAGITDHRIILHLINLKGENSLWNVEK
TNAIIAIEDIGIRVLLDRRIRNVFWASPDTDGGMPKSLDYSVEMGAQGKYLCLKNQRVEV
WSTIWIDFE

Enzyme Prediction     

No EC number prediction in MGYG000003661_00679.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH66	7	546	4.4e-102	0.9928057553956835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13199	Glyco_hydro_66	1.35e-126	10	545	1	557	Glycosyl hydrolase family 66. This family is a set of glycosyl hydrolase enzymes including cycloisomaltooligosaccharide glucanotransferase (EC:2.4.1.-) and dextranase (EC:3.2.1.11) activities.
cd14745	GH66	3.87e-110	94	409	1	331	Glycoside Hydrolase Family 66. Glycoside Hydrolase Family 66 contains proteins characterized as cycloisomaltooligosaccharide glucanotransferase (CITase) and dextranases from a variety of bacteria. CITase cyclizes part of a (1-6)-alpha-D-glucan (dextrans) chain by formation of a (1-6)-alpha-D-glucosidic bond. Dextranases catalyze the endohydrolysis of (1-6)-alpha-D-glucosidic linkages in dextran. Some members contain Carbohydrate Binding Module 35 (CBM35) domains, either C-terminal or inserted in the domain or both.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH30411.1	5.73e-132	6	546	12	565
QAT39898.1	9.37e-128	7	548	12	569
ABY92063.1	2.40e-124	7	549	5	565
ABY93935.1	4.78e-124	7	549	5	565
ADV78896.1	5.81e-124	9	549	2	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AXG_A	2.46e-40	7	546	46	608	Crystalstructure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus [Thermoanaerobacter pseudethanolicus ATCC 33223],5AXG_B Crystal structure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus [Thermoanaerobacter pseudethanolicus ATCC 33223]
5AXH_A	2.14e-39	7	546	46	608	Crystalstructure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus, D312G mutant in complex with isomaltohexaose [Thermoanaerobacter pseudethanolicus ATCC 33223],5AXH_B Crystal structure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus, D312G mutant in complex with isomaltohexaose [Thermoanaerobacter pseudethanolicus ATCC 33223]
5X7G_A	2.19e-34	84	546	116	720	CrystalStructure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase [Paenibacillus sp. 598K],5X7H_A Crystal Structure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase complexed with cycloisomaltoheptaose [Paenibacillus sp. 598K]
3WNK_A	1.44e-31	84	546	117	721	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNL_A	1.45e-30	84	546	98	702	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNM_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94286	3.55e-31	84	546	134	738	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 PE=1 SV=1
P70873	4.72e-31	83	546	125	730	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 GN=cit PE=3 SV=1
Q54443	3.82e-15	177	547	327	733	Dextranase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=dexA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003661_00679.