CAZyme Information: MGYG000003661_00681

Basic Information

• Species: Acetatifactor sp900554205
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900554205
• CAZyme ID: MGYG000003661_00681
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	MGYG000003661_53|CGC1	68465.64	4.7143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003661	3177635	MAG	Peru	South America

• Gene Location: Start: 7639; End: 9450 Strand: +

Full Sequence      

MKYIPTGNEYVTLDRIGEEHAGIEAISVLHMGYKGILEIAGGKEKGLMRPYCVCNGEAVE
ISNPVWERKHNWLPSFRFENESLLLEGVIFAPPGERGFFYSLTLSNKKTEQLDIALGLEG
SIHGLHHIMNESRCMKVTKEVKSSNWNHSVVFSFVGETDILSLAPIFDKEKETIVEEVSE
NGSDIAYRFYKMQSLAAGEKISFDGIWGLGYEEVSASTSAKELLRHGIEWEYGQTVRRLE
QLCNSRGKGQMLSEEIQKISDTNALFCYYYASGRTIDTEEAVMVTSRSDRYYVSAAFWDR
DAMLWAFPCILEMDAVYARELLLYVFGRQRRNIGMHSRYIDGTLLEPGFELDELAAPVYA
LTNYCMETGDREILRHPYVEEGIRLVLKRLEQYKHPQTELYETFLLPSDDETEYFYVTYD
NALLSVTLERLGKVIQEEGLDAEAALLLQKADSIRRAVLEHCVVENDGKKVYAWAVDLKG
KSKIYDEPPGSLQLLAYYGFVDRKDETYRNTVSLIRSRQYEFSFEGCYIDEIGCAHAAHP
WILSLANSLLCGDRQHALMLLERMSMDNGIACESVYENDGTCATGAAFGTCAGFLAYAIN
YEK

Enzyme Prediction     

No EC number prediction in MGYG000003661_00681.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	400	584	5.7e-19	0.48009950248756217

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3387	SGA1	3.62e-06	350	580	351	582	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKN24824.1	1.46e-189	4	603	1	586
ARP51233.1	1.46e-189	4	603	1	586
QKO31192.1	1.46e-189	4	603	1	586
QEY34932.1	2.37e-184	7	603	9	591
QQR05501.1	2.11e-182	3	601	5	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QT3_A	4.32e-12	346	603	129	422	Analysisof a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	7.85e-12	346	603	129	422	Crystalstructure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
2NVP_A	1.83e-11	346	603	129	422	X-RayCrystal Structure of Protein CPF_0428 from Clostridium perfringens. Northeast Structural Genomics Consortium Target CpR63. [Clostridium perfringens]
5M7I_A	3.22e-11	346	603	129	422	Crystalstructure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003661_00681.