CAZyme Information: MGYG000003661_01377

Basic Information

• Species: Acetatifactor sp900554205
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900554205
• CAZyme ID: MGYG000003661_01377
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000003661_96|CGC2	43838.77	4.8664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003661	3177635	MAG	Peru	South America

• Gene Location: Start: 29001; End: 30140 Strand: -

Full Sequence      

MQMPVFERYIDELIEKSTVEIPAWNIEKAKAGKAVGWNYIDGCMILALLEIYAATGERKY
YDFADAFIDHRVREDGSIAGYSVEEYNLDNINAGKTLFLLYGLNGKEKYRRAIELIYSQV
QNQPRTAEGNFWHKKIYPNQVWLDGMYMAQPFYMEYETKLHDRQNYKDIFGQFANVIRHM
RDEKTGLYYHGYDASREIFWCNKETGLSENFWLRALGWYSMALLDTLAKCEPGEEYRAEY
DMLRDAFVQLMESMLKLQDESGMWYQLPAQGDRKPNYLETSGSAIMAYSLLKGVRLGFLP
ESYREDGIRAFRGICDRYLKETENGLNLGGICLVAGLGPADNPRRDGSFDYYMSEPVVEN
DAKGVGPLLLAYTELRRLG

Enzyme Prediction     

No EC number prediction in MGYG000003661_01377.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	32	376	4.7e-111	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	6.76e-93	36	378	33	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.48e-78	36	378	26	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM04125.1	3.14e-241	3	378	1	376
CBL09353.1	3.84e-195	3	378	1	373
VCV21981.1	8.99e-194	3	378	1	373
CBL12002.1	1.81e-193	3	378	1	373
ABX40590.1	2.99e-192	3	378	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.12e-107	37	378	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	6.92e-71	37	378	39	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.91e-70	37	378	29	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	9.58e-14	36	323	64	337	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.11e-13	36	323	65	338	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.79e-70	37	378	39	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.71e-41	148	374	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.71e-41	148	374	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003661_01377.