CAZyme Information: MGYG000003662_01105

Basic Information

• Species: Prevotella sp900771975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900771975
• CAZyme ID: MGYG000003662_01105
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788		89301.31	6.5028

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003662	2760601	MAG	Peru	South America

• Gene Location: Start: 17332; End: 19698 Strand: -

Full Sequence      

MRKIVLSLCALCGLMQPMQAQIQTNAGVEYLQNNARDMSTDFSDMANTYFLADSITQFST
DKGEGKVNWKRYRLAPRQAFNLNGYWPVRQHMLDFPDTQYDNDPNLSIKVQPIDERTLRV
TMLTTSVEPNNEDATNPMFSPEFLQKVPSTEGWAITEGKNVICYKSKEGTFEIQKYPFRL
ILKDKNGRVLTQTRHIVDDDSTQVKLLPFCFIKRGSDNSRSIDPVFLLSPGERLYGCGES
FTSLNKVGQKVHLYVTDPQGPETDGMYKPVPFYFSNRGYGIFMNTSAPATCDFGASYIGA
QRLFLGDETMDFFLFFGEPKDILDEYTNVTGKSPMLPLWTFGTWMSRISYFSQKEGLEIA
KQLRAHKIPSDVIHFDTGWFGVDWQCDYAFAKDRFPDPVGMLRQLKKDGFHTCLWQLPYF
TPKNKYFQELVAGQMQVKNARGGMPYEDAVLDLSNPQTVNWYQSKIAGLIKQGVSAIKCD
FGEAAPFNGLYASGKTGFYEHNLYPLRYNKALWEAVRDNSGEGVIWARSAWAGSQRYPLH
WGGDAATNEQGNPGMMGDLRGGLSFGLSGFSFWSHDMGGFVTQSPDDLYRRWLPFGFLSS
HTRAHGAPPTEPWLISEDFTNAFRDCAELKYELMPYVYSQAKLCTEKGLPMVRAMFVEFP
HDAGSWYCEDQYMYGSQLLVAPLLEQGDSRTVYLPAGKWIDYQTGKVYDHGYQTISVPTK
ENTLNGRHPIPCVILVRDGSLLPTVPVAQSTDKIKWNEISWTPYKVDATSCVGYLFKPGD
SKVTIVTR

Enzyme Prediction     

No EC number prediction in MGYG000003662_01105.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	312	723	6.8e-121	0.9718969555035128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06593	GH31_xylosidase_YicI	2.31e-150	331	633	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
COG1501	YicI	1.20e-147	114	785	54	713	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
PRK10658	PRK10658	2.40e-147	82	722	4	665	putative alpha-glucosidase; Provisional
pfam01055	Glyco_hydro_31	6.18e-142	313	742	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	1.95e-61	225	718	75	609	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ80005.1	0.0	1	767	1	752
AGH14016.1	0.0	1	767	1	752
ADE83713.1	0.0	1	767	1	752
AGH14097.1	0.0	36	767	3	721
QUU01020.1	0.0	20	786	76	825

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7C_A	9.50e-124	207	746	178	719	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2F2H_A	1.44e-110	228	754	156	723	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	1.62e-110	228	754	156	723	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
1WE5_A	5.20e-103	228	754	156	723	CrystalStructure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
6JR6_A	9.04e-76	147	782	74	728	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31434	7.67e-110	228	754	156	723	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q5AW25	1.43e-98	183	743	133	697	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P96793	5.77e-92	232	708	158	646	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q9F234	2.40e-60	146	752	77	684	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9P999	3.35e-56	144	764	34	644	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000394	0.998190	0.000789	0.000219	0.000192	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003662_01105.