CAZyme Information: MGYG000003662_01154

Basic Information

• Species: Prevotella sp900771975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900771975
• CAZyme ID: MGYG000003662_01154
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550		62762.72	6.879

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003662	2760601	MAG	Peru	South America

• Gene Location: Start: 82770; End: 84422 Strand: -

Full Sequence      

MKTKKMFPDYIFESSWEVCNKVGGIYTVLSTRGKTLQEMMPDRIIFIGPDCWGDKNCPYF
ELDQTLFASWRFQAESEGLFVKVGRWSIPGKPIAILVDFKPFFSCKNEIYGQLWNDFQVD
SLHAYGDYDEASMFSYAAGRVVESIYKYYLDATKNVVYQANEWMTGLGLLYIKKHVPAIG
TVFTTHATSIGRSIAGNNKPLYEYLEAYNGDQMAFELNMQSKHSIEKQTAKYVDCFTTVS
DITATECKELLDKPVDVVLPNGFEDNFVPKGVSFTNKRRSARKKLLQVANALFGSELGDD
TLIVSTSGRYEFRNKGIDVYIESLNRLRGKTLAKPVLALVEVPAWVNRPRKDLQERLESK
KKYNTPLDTPWLTHTLHNLSEDRVTGMLRSLNMWNAKADNVKVLFVPCYLTGDDGIFNMS
YYDLVLGNDLCIYPSYYEPWGYTPLEAIAFKVPCITTDLAGFGLWVNKVLGHDGKITDGV
EVVHRTDYNYQEVAEAISETVRAYASMPKAEADKCRRNAFSLSKKALWKEFISYYEEAYD
IALKKAQERK

Enzyme Prediction     

EC	2.4.1.11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT3	13	347	4.6e-118	0.5447409733124019

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03793	GT3_GSY2-like	8.01e-77	10	463	3	510	glycogen synthase GSY2 and similar proteins. Glycogen synthase, which is most closely related to the GT3 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis. GSY2, the member of this family in S. cerevisiae, has been shown to possess glycogen synthase activity.
pfam05693	Glycogen_syn	3.35e-73	13	546	1	586	Glycogen synthase. This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3. Glycogen synthase (GS) is the enzyme responsible for the synthesis of -1,4-linked glucose chains in glycogen. It is the rate limiting enzyme in the synthesis of the polysaccharide, and its activity is highly regulated through phosphorylation at multiple sites and also by allosteric effectors, mainly glucose 6-phosphate (G6P).
cd03801	GT4_PimA-like	2.72e-11	136	539	65	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.93e-10	201	538	119	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	2.20e-08	227	460	133	302	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB27771.1	4.66e-303	1	550	18	568
QNT66178.1	1.49e-301	1	549	1	550
QJR97900.1	2.84e-291	1	544	1	544
ALO48849.1	1.09e-290	1	550	1	551
QUB74190.1	1.15e-290	6	549	2	546

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QLB_A	2.64e-65	10	545	47	638	StructuralBasis for the Recruitment of Glycogen Synthase by Glycogenin [Caenorhabditis elegans],4QLB_B Structural Basis for the Recruitment of Glycogen Synthase by Glycogenin [Caenorhabditis elegans],4QLB_C Structural Basis for the Recruitment of Glycogen Synthase by Glycogenin [Caenorhabditis elegans],4QLB_D Structural Basis for the Recruitment of Glycogen Synthase by Glycogenin [Caenorhabditis elegans]
3NAZ_A	3.93e-61	11	545	30	636	Basalstate form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NAZ_B Basal state form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NAZ_C Basal state form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NAZ_D Basal state form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NCH_A Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3NCH_B Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3NCH_C Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3NCH_D Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3O3C_A Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3O3C_B Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3O3C_C Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3O3C_D Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3RSZ_A Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RSZ_B Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RSZ_C Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RSZ_D Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae]
6U77_A	2.84e-60	11	545	10	616	yGsy2pin complex with small molecule [Saccharomyces cerevisiae S288C],6U77_B yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_C yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_D yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C]
5UX7_A	3.52e-60	11	545	30	636	Activatedstate yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_B Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_C Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_D Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C]
4KQ1_A	3.72e-60	11	545	29	635	Crystalstructure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_B Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_C Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_D Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ2_A Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_B Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_C Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_D Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O93869	4.86e-66	11	546	16	606	Glycogen [starch] synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gsy-1 PE=2 SV=2
Q9U2D9	1.40e-64	10	545	45	636	Glycogen [starch] synthase OS=Caenorhabditis elegans OX=6239 GN=gsy-1 PE=1 SV=1
Q8MJ26	2.90e-64	11	546	29	616	Glycogen [starch] synthase, muscle OS=Macaca mulatta OX=9544 GN=GYS1 PE=2 SV=1
P13807	1.06e-63	11	546	29	616	Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2
Q9VFC8	1.33e-63	12	538	52	639	Glycogen [starch] synthase OS=Drosophila melanogaster OX=7227 GN=GlyS PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003662_01154.