CAZyme Information: MGYG000003662_01955

Basic Information

• Species: Prevotella sp900771975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900771975
• CAZyme ID: MGYG000003662_01955
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000003662_72|CGC2	42302.15	6.6381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003662	2760601	MAG	Peru	South America

• Gene Location: Start: 70641; End: 71744 Strand: -

Full Sequence      

MKKILFFSIALLVLSACATQTLSTSSQTMKKKKVTTAELLTIRLASIQKKGYMAGHQDDP
FYGINWSYEPNRSDILETTGDYPAVMGFDLGGIEKADSKNLDSVPFNLIHDEAIRHAERG
GIVTFSWHPRNPLTGGTAWDVSSDQVVKSVLPEGKEYQKFQLWMQRVGDFLCTLKDSKGN
PIPIIFRPWHENNGSWFWWGQKLCTNEEYKALWNMLQDYLRGRGLDNLLWSYSPNLDGNW
SEERFLERYPGNDRVTLLGEDAYQWGKETDFITQISADLDFISKFAEKNNRLFALTECGL
KNMPDATWWTRVLKPVMDRYNICYFLLWRNDKNEYFGPSPDLPCAADFKALYSAKNVLFL
KDINNIK

Enzyme Prediction     

EC	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	34	331	1.2e-64	0.8910891089108911

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.64e-36	44	263	16	230	Glycosyl hydrolase family 26.
COG4124	ManB2	1.80e-15	139	263	144	256	Beta-mannanase [Carbohydrate transport and metabolism].
pfam08139	LPAM_1	0.007	1	18	1	18	Prokaryotic membrane lipoprotein lipid attachment site. In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognizes a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKF12291.1	1.76e-187	2	363	5	371
QVJ80423.1	1.83e-174	29	365	432	769
ADE83298.1	3.92e-174	29	365	366	703
QJE28714.1	7.45e-118	32	367	30	368
QUR49365.1	1.06e-117	32	367	30	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	6.90e-103	25	362	2	338	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	1.06e-61	44	359	49	387	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	1.06e-61	44	359	49	387	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	1.89e-61	44	359	72	410	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	8.17e-61	44	359	49	387	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	2.12e-43	48	366	69	414	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	7.39e-37	65	362	77	398	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	1.66e-22	75	331	79	327	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
G2Q4H7	3.96e-21	44	305	190	430	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55278	5.07e-21	69	263	73	266	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000085	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003662_01955.