CAZyme Information: MGYG000003662_02042

Basic Information

• Species: Prevotella sp900771975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900771975
• CAZyme ID: MGYG000003662_02042
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	MGYG000003662_78|CGC2	37145.23	6.6853

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003662	2760601	MAG	Peru	South America

• Gene Location: Start: 68750; End: 69733 Strand: -

Full Sequence      

MTRLLLIYLFIFVAIATQARGKYDNTDTLFVDQHGTTEFQTVNQALEVCRAFMEYKKVIY
IKKGIYKEKVIVPSWLTNIEIVGEDKDSTIITYADHANIPSPSTGKPMGTFRTFTVRVDG
TNITFKNLTIENNAPRLGQAVALHTEGTRLAFVNCKFLGNQDTIYTGRPYTYLFFKDCYI
EGTTDFIFGPSTAWFEGCEIFSKINSYITAASTPEDAPYGYVFCHCRLTAADSVDHVYLG
RPWRAFAYTLFMKTMMGTHIVPEGWHNWKDYHDPATEGTVRYYEYKNTGKGAASSVQRVN
WAKQLPADIAEKITPDVIFNGDTDWLP

Enzyme Prediction     

No EC number prediction in MGYG000003662_02042.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	319	1.8e-94	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	8.98e-68	29	326	7	303	pectinesterase
pfam01095	Pectinesterase	3.55e-65	31	322	4	298	Pectinesterase.
PLN02682	PLN02682	4.20e-63	28	327	70	368	pectinesterase family protein
PLN02304	PLN02304	1.52e-58	24	300	72	355	probable pectinesterase
COG4677	PemB	7.94e-58	38	321	93	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	1.17e-145	1	327	1	323
QVJ81978.1	2.01e-143	1	327	1	322
ADE82952.1	2.01e-143	1	327	1	322
AGB28242.1	7.98e-141	1	327	1	323
QQY38333.1	8.54e-136	19	327	16	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	2.21e-34	29	295	11	269	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	8.86e-34	31	313	7	298	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1C_A	1.18e-33	29	295	11	269	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	1.32e-32	35	326	15	308	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	4.62e-24	58	327	36	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.41e-48	31	326	9	305	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O23038	4.77e-47	24	326	86	388	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2
Q8VYZ3	1.56e-45	19	326	75	381	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q8GXA1	5.34e-42	16	327	245	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9ZQA3	1.14e-41	17	326	79	385	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.999253	0.000140	0.000145	0.000133	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003662_02042.