CAZyme Information: MGYG000003662_02194

Basic Information

• Species: Prevotella sp900771975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900771975
• CAZyme ID: MGYG000003662_02194
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		46311.61	8.7845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003662	2760601	MAG	Peru	South America

• Gene Location: Start: 12994; End: 14193 Strand: +

Full Sequence      

MNIITNKLNTLLPSIRGKGRGWGFLLCLLISLPLSAKTWTTDQVKDLIVRVNTYWQHNNK
AETRSFWDPAAYHTGNMEVYKLLKDEKQLDYTRRWAYHNNWSGATEADPRRWKYATYGEG
KDFVLFGDWQVCFQTYIDLYNLALANGGTDADNYFMVKRAKEVMHYEAYSKNDDYWWWSD
ALYMVMPVMTKMYKLTGDSQYLDKLYANLLYADRIMLDEETGLYFRDARYVYPKHKSVNG
KKDFWARGDGWVLAGLAKVLQDMPKDYKHYKFFVDKFQRLADIVAKTQQKEGYWTRSIMD
PNHAPGPETSGTAFFTYGILWGVNNGYLAKKDYKKCIDRAWQYISETAVQADGKVGYVQP
IGDCAIPGQTVDANSQANFGVGAVLLASCEYYRYINNQK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	393	6.5e-75	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.45e-78	48	394	10	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.14e-35	75	393	44	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ79822.1	3.76e-197	25	396	7	370
ADE82673.1	1.08e-196	25	395	7	369
AGB28481.1	3.60e-183	26	395	9	378
BCS84432.1	8.54e-176	43	395	9	363
QQY40390.1	9.39e-174	28	395	15	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	1.27e-163	35	397	24	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	6.01e-137	38	395	10	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	2.10e-50	33	390	17	365	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	4.40e-14	175	353	138	322	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.80e-13	175	353	128	312	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	6.55e-51	26	390	11	371	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.36e-49	33	390	24	372	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	7.19e-44	176	390	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.41e-13	175	353	138	322	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.515305	0.451365	0.031852	0.000330	0.000321	0.000823

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003662_02194.