CAZyme Information: MGYG000003665_00445

Basic Information

• Species: HGM10836 sp900772095
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; HGM10836; HGM10836 sp900772095
• CAZyme ID: MGYG000003665_00445
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
169		19480.38	9.9899

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003665	1605651	MAG	Peru	South America

• Gene Location: Start: 86823; End: 87332 Strand: -

Full Sequence      

MANSKILEPFILKWEGGFVYDKDDLGGATNMGVTLATYRSVFGSKKTVNDLKRMTRVQWS
VIFKKFYWDKWEADNIKDQNVANILVDWLWCSGSYGIKIPQRVLGVSVDGIVGSKTIAAI
NARDGRELFDTIKQERKDYIDRICQTRPQNKKFKKGWLNRINSLAYETD

Enzyme Prediction     

No EC number prediction in MGYG000003665_00445.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	10	93	1.5e-22	0.9534883720930233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05838	Glyco_hydro_108	7.95e-25	9	93	2	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
COG3926	ZliS	1.59e-24	9	162	10	162	Lysozyme family protein [General function prediction only].
cd13926	N-acetylmuramidase_GH108	2.10e-24	9	93	8	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
pfam09374	PG_binding_3	7.76e-13	95	160	1	74	Predicted Peptidoglycan domain. This family contains a potential peptidoglycan binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEW36826.1	6.00e-76	1	166	1	170
QUT83940.1	2.44e-75	1	166	1	170
AND20754.1	2.44e-75	1	166	1	170
QUT93282.1	5.90e-74	1	167	1	172
QBJ20189.1	4.74e-71	1	166	1	172

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NR7_A	1.99e-54	2	164	5	192	StructuralGenomics, the crystal structure of putative secretion activator protein from Porphyromonas gingivalis W83 [Porphyromonas gingivalis W83]
7DNP_A	9.61e-21	9	169	11	172	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003665_00445.