CAZyme Information: MGYG000003666_00892

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA6984
• CAZyme ID: MGYG000003666_00892
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262		29393.42	9.0377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003666	1550881	MAG	Peru	South America

• Gene Location: Start: 136; End: 924 Strand: +

Full Sequence      

MLKLLFKARSGKFDVVISAGGNKLISILLFLTGIKERYGYNTGSLSEKLLTKAIPLNKQK
YASLMYHDLITALTDIKTEIPEITLEQETKLPNSVLIHPGVSKLSVQKNMIKTITPEIWA
EVIKILLEKGKHVTLTGGPDDKEVVDKILSIIEPLNNPNFENYYGKTRNLMDLAKLITKY
EKFVCSDSAPLHIGVGTKTRTYAIFGSTDDKKLIPQADFVTALKTNDNCPIKPCLWDHRQ
TTCEKLSCLQFKPEDIANKILE

Enzyme Prediction     

No EC number prediction in MGYG000003666_00892.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	3	242	6.8e-34	0.9422222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	2.03e-29	1	229	70	301	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	3.77e-27	1	262	67	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	3.95e-18	5	246	4	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	7.74e-10	2	218	77	301	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38411.1	2.51e-123	1	261	68	327
BAU12214.1	1.72e-34	4	225	71	301
BAI93916.1	1.47e-30	9	225	76	300
QNH55727.1	1.47e-30	9	225	76	300
AMW31030.1	1.47e-30	9	225	76	300

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003666_00892.