CAZyme Information: MGYG000003669_00378

Basic Information

• Species: UMGS1933 sp900772235
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1933; UMGS1933 sp900772235
• CAZyme ID: MGYG000003669_00378
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		37688.93	4.657

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003669	1541608	MAG	Peru	South America

• Gene Location: Start: 1868; End: 2830 Strand: -

Full Sequence      

METRKEIPIFFTIDDGYAPYLSVAIKSMIQNASKEYNYRIIVLYKELNEENRAKIAKLKE
ENFKIDFIYMKDELKAITDREENRLRCDYFTLTIYFRLFIPEMFPEYDKGIYIDSDVVVP
GDISKMYNIDLGDNIVGACQDKSVVDVPELANYMEQAVGVDKYQYVNSGVLLMNLSKMRE
KQFSKRFLDLLNKYHFDSVAPDQDYLNAICNGKILYLDSSWDAMPTEGSKEIENPNIIHY
NLFQKPWCYDNIQYADCFWNYAKQTEYYDEIVQFKNNYSEEKKNADKECLENLIKKADQL
AKTGEITFKKAMENGEKVRI

Enzyme Prediction     

No EC number prediction in MGYG000003669_00378.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	5	250	1.5e-60	0.8871595330739299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	3.60e-72	7	247	1	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	2.06e-52	8	247	1	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	3.54e-46	7	247	3	244	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd00505	Glyco_transf_8	3.44e-24	9	247	4	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
cd06429	GT8_like_1	1.77e-15	7	247	1	240	GT8_like_1 represents a subfamily of GT8 with unknown function. A subfamily of glycosyltransferase family 8 with unknown function: Glycosyltransferase family 8 comprises enzymes with a number of known activities; lipopolysaccharide galactosyltransferase lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase and inositol 1-alpha-galactosyltransferase. It is classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT42779.1	1.20e-127	2	320	3	320
QOV18897.1	4.02e-117	4	320	5	334
BAP85032.1	4.13e-109	1	320	1	322
QLE67735.1	8.61e-103	7	320	6	319
QLE70164.1	8.61e-103	7	320	6	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	1.12e-24	7	258	302	579	ChainA, WbbM protein [Klebsiella pneumoniae]
1SS9_A	1.33e-24	9	226	3	212	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	6.41e-23	9	226	3	212	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
3TZT_A	1.30e-12	9	218	8	209	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
5GVV_A	2.25e-10	97	262	90	251	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43974	1.50e-30	9	227	41	250	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
P25148	6.68e-18	14	267	14	276	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
P27129	6.04e-15	1	247	22	272	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
A0A0H2URA3	6.28e-12	26	261	4	250	Glycosyltransferase GlyB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyB PE=3 SV=1
P19817	1.53e-11	9	247	28	270	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003669_00378.