CAZyme Information: MGYG000003670_00831

Basic Information

• Lineage: Bacteria; Eremiobacterota; Xenobia; Xenobiales; Xenobiaceae; Bruticola
• CAZyme ID: MGYG000003670_00831
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
205	MGYG000003670_530|CGC1	22884.36	9.15

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003670	1627385	MAG	Peru	South America

• Gene Location: Start: 1611; End: 2228 Strand: -

Full Sequence      

MFCVNKKKIAYLCLSVAWLLVSLGCPLKASAQEQLLQEPYKSKAYLNSYYQAVRYYNGNL
SDRDTKTIVLAILHYAYEYSLDPRFVTAVIACESGFNPKAVSPAGAIGLGQLMPDTAKSV
KTNDPYNINLNIRGACYLLKSHLLSYGCRNTVDLSYLPEAISLTLAAYNAGPGAVSKYKG
IPPYRETQNYVYNVTREYRRLCGRD

Enzyme Prediction     

No EC number prediction in MGYG000003670_00831.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	82	200	1.7e-25	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	2.64e-36	83	199	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	1.21e-34	72	200	8	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.40e-29	71	201	9	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	1.93e-26	72	175	1	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.63e-25	72	190	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARU42517.1	5.04e-39	49	203	79	229
ARU45121.1	4.55e-38	46	203	67	219
CCW36368.1	4.00e-34	49	203	226	380
AIE84994.1	1.33e-33	57	203	195	337
AEE96658.1	4.03e-32	71	196	92	205

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	7.58e-07	85	194	470	591	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
6FBT_A	2.49e-06	81	194	462	585	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	2.52e-06	81	194	491	614	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6GI4_B	3.59e-06	79	117	33	71	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]
6FC4_A	6.09e-06	81	194	463	586	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	5.01e-28	71	198	63	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	2.82e-24	76	198	1430	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	2.82e-24	76	198	1430	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	8.76e-14	78	156	17	95	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q3IHZ1	3.84e-06	77	176	288	382	Membrane-bound lytic murein transglycosylase F OS=Pseudoalteromonas translucida (strain TAC 125) OX=326442 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002335	0.887894	0.108904	0.000306	0.000273	0.000254

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003670_00831.