CAZyme Information: MGYG000003671_00093

Basic Information

• Species: HGM10818 sp900772445
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; HGM10818; HGM10818 sp900772445
• CAZyme ID: MGYG000003671_00093
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		46273.23	9.3023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003671	1177326	MAG	Peru	South America

• Gene Location: Start: 354; End: 1562 Strand: +

Full Sequence      

MFKIIYIIISILSGVYLTYFIILALGIFKKNDDKIISKKKNNFAILIAARNEEAVIGNLI
KSLKKQKYPDNLYEIFVIINNCTDNTEEVARKEGAKIIKCTETVKSKGEVLKYTFNYLKD
NNNIDAYVVFDADNVVHENFLNKMNDMINKGYSLAQGFRDTKNISDSWLTSSYALLYYIQ
SIFVNKARYNLGKSSFLNGTGFMVKKEVIDKHGYNPVTLTEDIEFTAICAVNDEKIGFAE
EAITYDEQVTTLKESLKQRKRWSFGTFQCLKNYGWTLIKKGIKEKKLECFDVVLFYLAFI
IQVISTFTFVISTFGMLIVLKRYDLTLITSLVLPIVSYIIGVVFRTIIIKKFNKDIKENI
GGILLFDLFLLTWVPVNLVCLFKKECNWDQIKHNRNVGDLSV

Enzyme Prediction     

No EC number prediction in MGYG000003671_00093.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	42	265	9.4e-27	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	8.24e-61	45	225	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	1.88e-38	19	376	32	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.25e-35	45	222	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	7.05e-22	41	265	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam13632	Glyco_trans_2_3	1.95e-14	127	320	1	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWW28570.1	1.79e-89	46	397	1	357
ADO38773.1	2.30e-88	19	397	22	405
ARD65366.1	2.30e-88	19	397	22	405
ALU13522.1	1.45e-86	19	397	22	405
QCT71577.1	1.45e-86	19	397	22	405

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8YMK0	4.81e-13	44	281	109	348	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	3.61e-12	44	281	109	348	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
P74165	8.76e-12	45	294	112	365	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q58619	7.67e-06	27	159	3	130	Uncharacterized protein MJ1222 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1222 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000004	0.000001	0.000000	0.000000	0.000004

TMHMM  Annotations     

start	end
5	27
298	320
327	349
359	381