CAZyme Information: MGYG000003671_00631

Basic Information

• Species: HGM10818 sp900772445
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; HGM10818; HGM10818 sp900772445
• CAZyme ID: MGYG000003671_00631
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000003671_53|CGC1	42912.72	5.0525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003671	1177326	MAG	Peru	South America

• Gene Location: Start: 7540; End: 8619 Strand: +

Full Sequence      

MKYKVCVYAICKNEENFVDRWYDSMKEADEIYVLDTGSSDDTVNKLKENGINVCIRKIEP
WRFDVARNMSLDLVCKDADICVCTDLDEVFESGWRSKLEECWDCGITRGYYDYNWSFDKY
GKPAVSFYRDKIHSRNGYKWTHPVHEVLEYIGDGYEKKKFIDGIILNHYPDNTKSRSSYL
PLLELSVKEDPNDDRNMHYLGREYMYYGRWRESIKTLLKHLDLPTATWKDERSASMRFIA
RCYYELGNVTLARIWLEKAIFETPYLREPLVEMGRLEYYEKNYDIASIYLEKALDIDNKY
KNYINETFCYDYTIYDLLSICKYEMGNYKDSLYYVTKAVKMDPDNDRLISNKKIIEEII

Enzyme Prediction     

No EC number prediction in MGYG000003671_00631.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.84e-09	4	170	1	165	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	1.09e-06	239	340	7	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	1.14e-06	197	295	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
COG0463	WcaA	8.01e-06	1	302	1	291	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
sd00006	TPR	4.86e-05	268	352	2	75	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX65321.1	2.43e-143	3	357	4	358
ACV63878.1	9.38e-136	2	358	3	358
AQS58819.1	7.91e-133	4	356	5	357
QIB69610.1	4.53e-132	2	359	3	360
AQS58818.1	6.92e-131	4	356	5	357

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003671_00631.