CAZyme Information: MGYG000003672_01055

Basic Information

• Species: CAG-594 sp900772415
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-594; CAG-594 sp900772415
• CAZyme ID: MGYG000003672_01055
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 2D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635	MGYG000003672_54|CGC1	72122.55	9.7086

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003672	1172535	MAG	Peru	South America

• Gene Location: Start: 66963; End: 68870 Strand: -

Full Sequence      

MLLFCLSYTILFLCAKYGSKIDIESSNSIYMYDKNKKSFYEGNNGTKKWIKLKNISKNLV
NATIYSEDKNFYKHNGFDIPRIIKSAFINIKSKDLTQGASTITQQYARNLFLTFDKTWER
KIKEAWYAFKLESQYSKNEILEGYLNTINYGNGIMGIENAAEYYFNKSAKDLTLAESTML
AGIPKSPDNYSPLNDLNAAKKRQKEILKSLVNNNIITKKQMDETTNIKLSYYGKKENLNL
STLMYYQDAVIRELQDLKIVSENTIRKEGLKIYTSLDINAQTVLDDAIKNNLEGKKEMQT
SVVVMNPNNGEVMALAGGKDYSKSQYNRAVQSKRQVGSTMKPILYYAALENGLTASTTFL
SKPTTFTLDNGLSYSPSNYGNIYPNDKITMALAICYSDNIYAIKTHLFLGEDMMIKYAKK
MGIKSKLEANASLPLGTNELSILEFTNAYATLANSGYNVKEHLIKKVEDGNGDVLYEYKK
KKVKVLNKSYTYILSELLSNTYNTSLKSYTSPTCASIKPKLTKKYAVKSGTTDYDLWTVG
YNPDIVVGVWTGYDDNRKLTNKEYKYAKNIWADVVEGYLREKEAKWYKKPDNVVGVLTDV
NTGKEATNDSKLKTILYYIKGTEPGYKQIKKTAKN

Enzyme Prediction     

No EC number prediction in MGYG000003672_01055.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	44	210	4.5e-65	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	0.0	49	580	4	530	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	5.71e-176	24	573	51	591	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	7.02e-137	50	624	70	764	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.56e-80	49	211	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
PRK11636	mrcA	5.28e-74	45	624	62	828	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZV62027.1	5.13e-185	41	624	67	653
QYF83258.1	1.03e-184	41	624	67	653
QNK49558.1	5.82e-184	41	624	67	653
QOS91684.1	7.97e-184	28	624	54	653
AZV45469.1	2.32e-182	41	624	67	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	2.63e-65	31	610	10	619	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	3.90e-62	31	610	19	628	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
4OON_A	2.83e-59	50	606	42	750	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2JE5_A	4.60e-57	50	586	57	641	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]
3ZG8_B	2.79e-56	130	591	2	468	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70997	8.06e-163	13	624	39	653	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
O66874	1.98e-75	49	624	65	712	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P40750	4.89e-75	22	580	49	621	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
Q5FAC7	4.80e-72	47	594	68	721	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3
O05131	4.80e-72	47	594	68	721	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.787636	0.208427	0.002725	0.000347	0.000241	0.000625

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003672_01055.