CAZyme Information: MGYG000003674_00067

Basic Information

• Species: Prevotellamassilia sp900772575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900772575
• CAZyme ID: MGYG000003674_00067
• CAZy Family: GH37
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		59685.78	9.1164

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003674	2595876	MAG	Peru	South America

• Gene Location: Start: 49614; End: 51167 Strand: +

Full Sequence      

MKRKRFAAIVGFTLTVTLSAMSQNISFPSDAERPDWQHEIPRVVYPDTGLVQLYNTTWKI
ASARVRRGPEGMVASPYLDENCYEDQIWIWDGCFMVLFSKYAPKAFPGKETLLNYYVPIH
DHVKTPLLIHLRDNPPIFAWVEQENYRFMGDTAQADFVVKNKRYLQRHYEYFNTIPKGDV
NTDVSPAYNPIHRGIVRDTDGQIIGYTWTGGASGMDNTPRGRDAGGWDSIMWVDAICQQA
LSALNISRLCRERGMKTEAHQWQREYNRLKHIINERYWDETDGFYYDINRRTGKPCRIKT
PASYWAMLAEIPSAKQAKRMVSYLRSADFMGGVRPWNSLARDDRDYDGRTGNYWRGGIWL
PMVYMGTKALEKYGYTALADSLAENVVRLQMRTFYDYTPHTIWECYSPVADKPSTEVGHT
ARPDFCGWSALGPISLFIENILGFRYANAQTHTLTWDLKPSVGTYGIKNFKFGDIQADII
YHHDTGNIRITTNRPFRLRLPARTIKVKSGTHDYRAL

Enzyme Prediction     

No EC number prediction in MGYG000003674_00067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	242	429	2.7e-20	0.3604887983706721

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01204	Trehalase	1.33e-14	130	397	175	466	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	4.41e-13	165	431	195	487	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG3408	GDB1	5.40e-11	193	443	381	609	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG1626	TreA	6.11e-11	210	398	325	510	Neutral trehalase [Carbohydrate transport and metabolism].
PRK10137	PRK10137	8.13e-11	254	384	599	737	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO96172.1	1.40e-200	6	510	10	506
QWP70936.1	1.40e-200	6	510	10	506
QWO91044.1	1.40e-200	6	510	10	506
QWO93599.1	1.40e-200	6	510	10	506
QWO86291.1	1.40e-200	6	510	10	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.81e-08	147	452	494	811	Crystalstructure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
4WVA_A	8.47e-08	275	396	274	396	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
2Z07_A	6.06e-07	275	396	274	396	Crystalstructure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus],2Z07_B Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus]
3W7S_A	7.70e-06	254	388	572	714	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	7.70e-06	254	388	572	714	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	1.81e-24	41	480	7	428	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P49381	2.15e-10	258	448	526	723	Cytosolic neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=NTH1 PE=1 SV=1
O14255	1.88e-08	77	440	410	807	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
P53008	1.32e-07	147	443	524	831	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
O42622	8.72e-07	262	397	515	651	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000726	0.233656	0.765235	0.000166	0.000132	0.000098

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003674_00067.