CAZyme Information: MGYG000003674_01616

Basic Information

• Species: Prevotellamassilia sp900772575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900772575
• CAZyme ID: MGYG000003674_01616
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1203	MGYG000003674_219|CGC1	132004.86	4.9219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003674	2595876	MAG	Peru	South America

• Gene Location: Start: 12457; End: 16068 Strand: +

Full Sequence      

MKRMLLRLPLLLLALGAVMTATAAEKANPTVISKLLDRVTGAADKFETVLDDQLATATAK
EVFVISAKSGKPCIKGSSLSAITTGINWYLNHYAHVNLAWNRLTADLSAIALPVPEAEER
HEALVGYRYYLNYCTFSYSMATWTWERWQKEIDWMALHGINMPLQIVGLDVVWQKLLTKD
LGYTKAEANNFIAGPAFQAWWGMNNLQGWGGPNPDWWYERQEALCKRILARERELGMEPV
LPGYSGMVPSDIGKKGYAANEQGGWCGFVRPYILDPNSSAFSTISAKYYARLKEVMGTSR
YYSMDPFHEGANTSGIDVPSAYSKIAQAMTTANADGHWVIQYWQWSGAQFNVLDKVAKGK
LIVLDLYSDAHTHFGEYKGHDAVYCMLPNFGGRTGFFGRLNKVMTDFFTQKARYSNVRGI
GATPEAIEQVPILYDALFELPWRAEAPDPADWVKDYAVARYGTANAAAAQAWEKLRTSSL
DCQTALQGPMEAVVCARPALTVNSVSTWGGTEIFYDPQEVVRAAALLTASGLSGENHSFD
VTDLNRQALTDYAYYLLKAINSAHTAGDTRAYAQRRDLFLGLILDIDRLLSTNSTFMVGH
WTKMARAIADEARGTTEADRQWLELDNARTLISTWGARAQSEEGGLRDYSYREWGGMMKD
YYYARWKAFFDNLDAGTSQPDWFTKDWDWAHNANLSYSDTPTEGTTEVAAELFRKYFLLY
TTADGVPYYIYRGFGQDYDKIIEATAYRGEVFTLSGVDASEADGVSLCVDVNDDGVFSET
ERGTSAFTVPADAATGSVKAMLCLADGTEVYFTIVLRDSVSAPREVKVATADKSQGTAAI
DGTTATSISTTADVVLRATAATGYDFLNWTDDKGNVVSTANPYTYYGKDAAAFTANFIVN
KWGAPAEDLKDMADIRSYAQYVARLTVAQNGAEARTIYTADECPSTLFHTTQIVNASKGS
ALSLAWQDPGTGGLGYCRLSAYIDLNGDGDFDDDGEFLAVIGNKETGTNAQVANGSLNIL
LPYDMPLGITHVRLRFDGAWSGGWDSATDAKPAKAATQRMVYDVPVNVTAYATTACSVTV
ATADAKQGTVDANGQPDTYIYGAGEDVVLRAYPADGYAVSHWTDSHGRRVPTAWQDGNFL
RFKAPESGTYTVHFVKSETLAVAGVTAGNQADLPYYYDLHGRPTDGKGRGICISRDGAKT
FRP

Enzyme Prediction     

No EC number prediction in MGYG000003674_01616.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	70	714	4.2e-192	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	1.20e-156	128	444	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.35e-65	452	709	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	9.32e-16	32	113	3	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.
pfam18998	Flg_new_2	0.002	853	897	24	70	Divergent InlB B-repeat domain. This family of domains are found in bacterial cell surface proteins. They are often found in tandem array. This domain is closely related to pfam09479.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12583.1	3.09e-233	11	717	4	718
ALJ43270.1	5.87e-191	10	714	6	730
QRQ55998.1	1.59e-189	10	675	6	680
ALJ49197.1	1.59e-189	10	675	6	680
QUT42246.1	3.55e-189	10	714	6	730

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	6.46e-126	32	712	174	869	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	7.85e-126	32	712	182	877	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	8.13e-125	32	712	197	892	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	2.72e-95	41	717	20	712	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	1.85e-94	41	717	43	735	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	3.90e-83	74	717	97	805	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000217	0.999102	0.000182	0.000171	0.000152	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003674_01616.