CAZyme Information: MGYG000003675_00070

Basic Information

• Species: Faecalibacterium sp900551435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900551435
• CAZyme ID: MGYG000003675_00070
• CAZy Family: GT26
• CAZyme Description: UDP-N-acetyl-D-mannosaminuronic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258	MGYG000003675_14|CGC1	29847.68	9.7336

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003675	2696714	MAG	Peru	South America

• Gene Location: Start: 8299; End: 9075 Strand: -

Full Sequence      

MAEQTLQMAEKRYPILNTYVNALSMQETVAYVEDVIRRRTPPVQHVVINALKVNLMESDP
ELRKIVNDCPLINADGASILWAAKKLGIPLTERVTGIDLFLELVKTAAEKGYKIYLFGAK
KEVVEKVRDIFQQQYPKLQIAGWRDGYFTPEQEPQIVADMAASGADMMFVAFSSPKKEYW
VYKYLHQLNIPFVMGVGGSFDVVAGVTKRAPELWQKLGMEWFYRFIQEPRRLWQRYAVGN
AEFIRHVNRAVREQKRRN

Enzyme Prediction     

No EC number prediction in MGYG000003675_00070.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	66	235	4.5e-65	0.9883040935672515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1922	WecG	2.30e-86	12	252	9	249	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].
cd06533	Glyco_transf_WecG_TagA	2.18e-85	66	236	1	171	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.
pfam03808	Glyco_tran_WecB	1.04e-82	71	236	3	169	Glycosyl transferase WecB/TagA/CpsF family.
TIGR00696	wecG_tagA_cpsF	4.94e-56	65	240	2	176	bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family. The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK03692	PRK03692	2.55e-42	46	235	39	227	putative UDP-N-acetyl-D-mannosaminuronic acid transferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI71302.1	1.21e-109	11	244	5	237
BCB22868.1	1.08e-101	12	244	2	233
QIK58242.1	7.32e-99	25	244	1	219
AQW25788.1	1.73e-98	10	247	2	238
AWS25092.1	1.73e-98	10	247	2	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MPK_A	1.72e-50	49	231	39	221	ChainA, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_A Chain A, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9]
5WB4_A	2.04e-39	49	205	39	195	Crystalstructure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_B Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_C Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_D Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_E Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_F Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_G Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_H Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9]
5WFG_A	4.06e-39	49	205	39	195	Crystalstructure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_B Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_C Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_D Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_E Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_F Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5RFQ9	1.06e-35	46	232	42	228	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=wecG PE=3 SV=1
B4SZ40	1.06e-35	46	232	42	228	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Salmonella newport (strain SL254) OX=423368 GN=wecG PE=3 SV=1
B5FN88	1.06e-35	46	232	42	228	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Salmonella dublin (strain CT_02021853) OX=439851 GN=wecG PE=3 SV=1
B5QVI6	1.06e-35	46	232	42	228	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=wecG PE=3 SV=1
P37457	1.06e-35	46	232	42	228	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=wecG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003675_00070.