CAZyme Information: MGYG000003675_00537

Basic Information

• Species: Faecalibacterium sp900551435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900551435
• CAZyme ID: MGYG000003675_00537
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	MGYG000003675_57|CGC1	55248.26	4.8719

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003675	2696714	MAG	Peru	South America

• Gene Location: Start: 26230; End: 27747 Strand: +

Full Sequence      

MAQFVKLNPKSLRELHVGSDRLVSYNVEMTEITGGTFWKAYTPGQIAGTEPFVLKGGFGG
NTTANSDLMQYYEPIDLYNEKLRKLAKEIGPAWVRVSGTWSTKTYYDFDGHTNGVIPEGY
NAVMTRAQWVGVLDFCKFLGAKLLISVADCEGLHHADEPWNPSQAEQIFALSKEYGVSID
AAEFVNEPNLLAISGCPKGYTAQQFVRDQDIFIRWLKANYPDCLYVGPCTVEGVGGATEE
HKSQGGGIGDILPQCSTDDLMNGAQEKLDVYSYHYYNGVSERLESIMPHSHWKADAATTE
AYLSVATNMAKFHAEKRDIYCPGGEMWVTESGDAGGGGDTWASTYLDVFRTLNELGGFSA
VTKGIIFHNTLASSDYGYLKPEVFDPRPNYFAVLLWNRLMGTTVYDSSEPVREGAHVYAH
SRADGKPGKAYLVINNSLTDATTVTLPKDAEIYQLSAETLRSQTMLCNGKALVLGKNNAL
PEIAPVAASAGELVLPAATCTFIVL

Enzyme Prediction     

No EC number prediction in MGYG000003675_00537.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	74	505	2.5e-69	0.9428571428571428

CDD Domains     

MGYG000003675_00537 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN98036.1	2.17e-243	1	505	1	509
SNU86930.1	9.08e-216	1	505	1	507
QTH47273.1	4.44e-212	1	503	1	508
SNV43376.1	2.55e-211	1	504	1	509
AXI08463.1	1.68e-210	1	505	1	504

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RG8_A	1.44e-10	121	505	6	378	ChainA, Heparanase 50 kDa subunit [Homo sapiens]
5LA4_A	4.41e-09	75	505	39	500	Crystalstructure of apo human proheparanase [Homo sapiens],5LA7_A Crystal structure of human proheparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens]
5E8M_A	1.75e-07	143	505	18	380	Crystalstructure of human heparanase [Homo sapiens],5E97_A Glycoside Hydrolase ligand structure 1 [Homo sapiens],5E98_A Crystal structure of human heparanase in complex with HepMer M04S02a [Homo sapiens],5E9B_A Crystal structure of human heparanase in complex with HepMer M09S05a [Homo sapiens],5E9C_A Crystal structure of human heparanase in complex with heparin tetrasaccharide dp4 [Homo sapiens],5L9Y_A Crystal structure of human heparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens],6ZDM_AAA Chain AAA, Heparanase [Homo sapiens]
5L9Z_A	4.09e-07	143	505	18	380	Crystalstructure of human heparanase nucleophile mutant (E343Q), in complex with unreacted glucuronic acid configured aziridine probe JJB355 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FF10	2.81e-16	75	486	75	514	Heparanase-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At5g07830 PE=2 SV=1
Q9LRC8	5.72e-13	75	486	73	492	Baicalin-beta-D-glucuronidase OS=Scutellaria baicalensis OX=65409 GN=SGUS PE=1 SV=1
X4Y2L4	1.62e-12	75	483	40	458	Hyaluronoglucuronidase OS=Hirudo nipponia OX=42736 PE=1 SV=1
Q8L608	2.40e-12	75	486	72	510	Heparanase-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At5g61250 PE=2 SV=1
Q9Y251	2.54e-08	75	505	73	534	Heparanase OS=Homo sapiens OX=9606 GN=HPSE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003675_00537.