CAZyme Information: MGYG000003675_01077

Basic Information

• Species: Faecalibacterium sp900551435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900551435
• CAZyme ID: MGYG000003675_01077
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		34170.4	5.6378

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003675	2696714	MAG	Peru	South America

• Gene Location: Start: 30953; End: 31900 Strand: -

Full Sequence      

MLHLTVKQDGSGDYATISEAVLAVPYALEAEITIGPGVYREKLVCEKRCITLRGAGADQT
ILIHADGGKLPHPDGRPTHTFRSYTAFFSGESVTVEDLTIANDAGPGSLVGQSIAAYVDS
DRAVFRRVKLLSNQDTLFCAPLPEQEREKDGFLGPRTFAPRRPSVQYYQNCEIAGDIDFI
FGGADALFEQCTLRTVNNHIPHSYVTAPSGPADGLGFVFWDCDFCSDCPEGTVFLGRPWR
PTGKTSVLDCRLGVHIAPEGFSGWNDRTDTDLARFAEAGSSGPGARPRPAWVAAPDAAEA
STLLTRARKRCRPQF

Enzyme Prediction     

No EC number prediction in MGYG000003675_01077.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	302	2.5e-73	0.9618055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.40e-52	13	286	93	380	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.28e-45	3	285	1	266	Pectinesterase.
PLN02773	PLN02773	9.95e-41	4	305	7	292	pectinesterase
PLN02432	PLN02432	1.98e-39	4	307	13	284	putative pectinesterase
PLN02682	PLN02682	6.95e-35	7	291	75	343	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA44050.1	2.58e-203	1	313	1	313
ATP00222.1	2.58e-203	1	313	1	313
AXA81880.1	4.30e-182	1	314	1	314
CBK98674.1	1.23e-181	1	314	1	314
AXB27671.1	1.49e-174	1	312	1	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.00e-26	6	285	7	269	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.32e-23	3	285	8	273	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	3.09e-22	37	285	68	335	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	3.13e-16	14	285	18	311	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	2.79e-12	4	284	11	265	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.99e-31	6	284	9	269	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9LUL8	1.00e-28	3	284	660	921	Putative pectinesterase/pectinesterase inhibitor 26 OS=Arabidopsis thaliana OX=3702 GN=PME26 PE=2 SV=1
Q9LXD9	6.19e-28	4	284	241	514	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
Q9SIJ9	7.33e-28	4	285	51	300	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q43062	1.82e-27	6	285	211	474	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003675_01077.