CAZyme Information: MGYG000003676_00212

Basic Information

• Species: Fusicatenibacter sp900772675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Fusicatenibacter; Fusicatenibacter sp900772675
• CAZyme ID: MGYG000003676_00212
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000003676_37|CGC1	36695.87	8.3475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003676	1891122	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 838; End: 1791 Strand: -

Full Sequence      

MSQYTVDVMIPTYKPGQEFAELLPRLLEQTYPIRSIRVVNTGKKFWNPAWEQLSDKIMVE
HIRPSEFDHGGTRRAMAESSDADLLLFMTQDAMPYDNACVEHLVEKFSLPHVKAAYARQL
PRDDCRTLERFTRGFNYPDESDIKDAGDLSKLGVKTFFCSNVCAMYDRRTYEELGGFVES
TLFNEDMIYAGHLVQAGYAIAYAADAKVVHSHNYGCLAQLHRNFDLGVSQAQHPEIFDAY
PSESEGIRMVKKSASYVCKIHKPWLLVTLFFQSGFKYVGYFLGKRYKSLPDSVIRWCTSN
KTWWEYHGKIRKKRNRR

Enzyme Prediction     

No EC number prediction in MGYG000003676_00212.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	4.16e-09	5	222	55	275	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
COG1216	GT2	2.42e-08	10	210	9	219	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06423	CESA_like	7.64e-07	8	182	1	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd04185	GT_2_like_b	5.26e-06	8	225	1	187	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04186	GT_2_like_c	7.25e-06	159	212	112	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV20105.1	1.06e-148	1	305	1	305
QNM10252.1	1.08e-133	1	305	1	305
QBE96877.1	1.85e-130	1	304	1	304
QMW79879.1	1.85e-130	1	304	1	304
QIB57343.1	1.85e-130	1	304	1	304

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	3.33e-60	6	304	3	302	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003676_00212.