CAZyme Information: MGYG000003677_01109

Basic Information

• Species: HGM11368 sp900772745
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA3700; HGM11368; HGM11368 sp900772745
• CAZyme ID: MGYG000003677_01109
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569		64174.71	8.3652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003677	1306285	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 41; End: 1750 Strand: -

Full Sequence      

MATNKTTKTVEEPKKVATAKTAPKQTATKTCSKSAPKTCASTVQKPCAKSAVAAKTAAKK
PNAKAEKAVEKKVVMTEQPAPVEPQNSKQVAQNDNKKKILFVASEALPYVKSGGLADVAG
ALPKSLNKLGCDTRVILPLYMDIPNSFRQTMVYVGNCYVTLSWRYQYCGIFTQQYDGVTY
YFIDNEYYFKRHGLYGHYDDGERFAFFSKAVLECLKVIDFKPDIIHCNDWHSALTPVFLD
CFYRGQDETRNTKTVFTIHNIEFQGKYGDGMISDVLGLDQNARQLVELDGCVNFMKGGIE
CSNKVTTVSPTYANEILTPFFGYDMQKILNNRRYKLSGIINGIDTAKLDPMTDKSLFKNF
NLESFGDKVKNKTALQELLGLPVREDVAMIGMVGRLTHQKGLDLLTCVIERLLNMDIQLV
ILGTGDWKYENQLKEIQNRYSGRLRAIINFSSDMASKIYGATDMFLMPSKFEPCGLSQMI
AMRYGSIPIVRETGGLKDTVPPYNHETKEGRGFTFVTYNADDMLYAIERAVGLYYDYKEE
WKQVVHNAMTADFSWDNIAKQYLELYDNL

Enzyme Prediction     

EC	2.4.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	98	567	4.5e-180	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	98	566	2	475	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	98	569	2	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	98	569	2	463	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	98	566	1	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	1.37e-113	98	569	5	479	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK41915.1	3.96e-176	98	569	2	471
BCI60006.1	1.13e-175	98	569	2	472
CAB1243454.1	1.13e-175	98	569	2	471
AFS77673.1	5.03e-175	98	569	2	475
QSF42595.1	8.80e-175	98	569	2	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	2.76e-91	97	567	125	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	1.87e-87	98	569	2	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	3.29e-87	98	569	2	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.54e-86	98	569	2	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	1.85e-85	99	566	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q97GX6	1.28e-173	98	566	2	473	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
B7GK04	1.82e-167	98	569	2	474	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1
B2V049	4.21e-167	98	569	2	475	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
B2TR28	4.21e-167	98	569	2	475	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1
A4IS20	3.48e-165	98	569	2	474	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003677_01109.