CAZyme Information: MGYG000003678_01953

Basic Information

• Species: CAG-95 sp900553305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp900553305
• CAZyme ID: MGYG000003678_01953
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000003678_286|CGC1	37398.25	4.7784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003678	2408138	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 14835; End: 15797 Strand: -

Full Sequence      

MRTIPCNPNAQPEVKEVLEYLSQIEGKGILTGQHTQTMEQPEIWRIRKITGKLPAICGFE
LLSYSPNIRRETADEECLKEVDENTGTLEKAWEWAERGGLMTFTWHWFSPMGGSDKSFYA
EKTDYNAAKAVIEGTPEHEALCHDLDHMAGILQPFCDRHIPILWRPFHESEGEWFWWGAK
GPVVAAELFRFMFRYYTQHHHLDNLIWVWNSPLPEGYVGDEYCDIISRDLYTEPHVHGAY
EEQYEELLKVTRQEKGAALGEIGILPDPETLVEKKIPWLWYMTWSFDFALNEKFNSDTAL
KKLYESSYAIDLEKYKSRTY

Enzyme Prediction     

No EC number prediction in MGYG000003678_01953.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	7	313	3.6e-91	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.01e-50	7	310	2	307	Glycosyl hydrolase family 26.
COG4124	ManB2	1.02e-09	151	231	163	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK45707.1	1.26e-146	1	314	2	316
CQR54080.1	5.38e-144	1	313	5	318
AIQ66101.1	1.12e-143	5	317	10	323
QUL56288.1	8.85e-143	5	313	9	318
AIQ67637.1	7.23e-142	5	314	9	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	1.11e-62	7	314	147	446	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	1.26e-60	3	295	4	290	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
6Q75_A	5.57e-41	5	304	23	316	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	1.77e-40	5	313	34	350	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	3.25e-40	6	292	46	321	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	8.60e-64	7	314	176	475	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
A2R6F5	8.40e-54	9	312	32	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
Q5AWB7	1.82e-50	3	314	26	349	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55296	1.98e-44	7	317	159	462	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P49425	1.07e-43	5	288	139	433	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003678_01953.