CAZyme Information: MGYG000003679_00091

Basic Information

• Species: Treponema_D sp002449305
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp002449305
• CAZyme ID: MGYG000003679_00091
• CAZy Family: GT26
• CAZyme Description: N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000003679_9|CGC2	28627.73	10.4857

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003679	2427938	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 20641; End: 21381 Strand: -

Full Sequence      

MAVQRIELLGVPVDVCSKQDLEEKILQLLEKKGPSQISFITIWDFMKIRRKNEYAESIRN
ADLILPISKSILSGAKFLNKTVPFRHNPFDAFISILSILESRYKSFYIFGGRKKALAAAE
KNMRSTFRGLQIVGRCVGYYQKQDEENIIQAISKASPSLVLVSEGIKKKDFWSYSNKERF
SSGIFMYYRDAVGILGKRIKRVNPKTFEKGHEIWGEIIRNPLRIFLIFPFLWYIILLVWT
KLFKKD

Enzyme Prediction     

No EC number prediction in MGYG000003679_00091.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	58	211	1.2e-25	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1922	WecG	1.09e-39	5	246	9	253	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].
pfam03808	Glyco_tran_WecB	8.66e-39	61	225	1	166	Glycosyl transferase WecB/TagA/CpsF family.
cd06533	Glyco_transf_WecG_TagA	6.38e-21	58	186	1	129	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB13036.1	5.42e-171	1	246	1	246
QQA00783.1	1.35e-116	1	245	1	245
QNL96733.1	1.81e-102	1	246	1	246
AEE17661.1	2.51e-100	1	246	1	246
QTQ15518.1	2.81e-99	1	246	1	246

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
224	243