CAZyme Information: MGYG000003679_01525

Basic Information

• Species: Treponema_D sp002449305
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp002449305
• CAZyme ID: MGYG000003679_01525
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		40061.34	6.646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003679	2427938	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 11768; End: 12859 Strand: +

Full Sequence      

MKNVVLKFLAFLLVFFPLYSKTSAEKIWNSLSEIEKISQIFLVNVEGNEIFHPVEFLEDG
TAVVPGGIILFSYNIGNSKNQLKDYIFSINSFYKKNKSPLPFIAVDQEGGEVNRLKKITS
HLPSEKKISENYTLKEAKSIYSNQAIQMKELGITMNLAPVAEAEIESNKVFLGTRTFGGV
PNSVAYSMICVRAYEENGIASVAKHFPGNANSDPHTGSVEITLSPSEVFKSFIFPFALVL
KSNPSCVLVSHAKINSLDENPACMSSFWIKEILQSYLGFKGLVLSDDVFMGALSDSPPEQ
VAANAIISGVDVIMLSEKKFLSVAKSLLNLAANDKFFANRLCAAEKKVLDFKLEKGIIKI
EEN

Enzyme Prediction     

No EC number prediction in MGYG000003679_01525.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	101	314	2.8e-37	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	8.84e-43	35	349	4	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	8.49e-42	35	359	5	319	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	2.62e-24	66	315	27	279	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.81e-05	199	314	204	319	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB13960.1	4.20e-229	1	363	1	363
QQA00274.1	2.98e-113	20	359	20	364
QSI02896.1	3.20e-98	29	363	55	396
AEE17330.1	2.95e-92	30	361	72	406
QNL98360.1	8.32e-90	30	362	29	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5G1M_A	2.27e-22	66	290	48	268	Crystalstructure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G1M_B Crystal structure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G2M_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G2M_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G3R_A Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G3R_B Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G5K_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5G5K_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
7VI6_A	4.74e-22	65	315	26	276	ChainA, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI6_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_A Chain A, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
6JTI_A	4.41e-21	66	318	70	327	Crystalstructure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_B Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_C Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_D Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_E Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_F Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTJ_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_C Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_D Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_E Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_F Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTK_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_C Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_D Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_E Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_F Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTL_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with zinc ion [Neisseria gonorrhoeae],6JTL_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with zinc ion [Neisseria gonorrhoeae]
5G5U_A	5.19e-21	66	290	48	268	Crystalstructure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G5U_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_A Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_B Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5LY7_A Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5LY7_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
4ZM6_A	1.85e-19	66	316	40	299	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0AF74	1.52e-24	66	292	29	258	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
P44955	3.82e-23	42	319	5	282	Beta-hexosaminidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagZ PE=3 SV=1
P48823	6.07e-23	66	315	65	335	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
A5UDA9	1.34e-22	42	340	5	304	Beta-hexosaminidase OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=nagZ PE=3 SV=1
Q3J953	2.22e-22	66	315	29	282	Beta-hexosaminidase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000577	0.998410	0.000464	0.000184	0.000183	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003679_01525.