CAZyme Information: MGYG000003679_01661

Basic Information

• Species: Treponema_D sp002449305
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp002449305
• CAZyme ID: MGYG000003679_01661
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		46145.97	5.4907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003679	2427938	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 9433; End: 10668 Strand: +

Full Sequence      

MKFKSIFSVFIALVLFLSPACSAPSESTDETLGLGTDFMRGFDASMVSQLEEYGSSFYNE
NGTKEDIFKILKVHGVNWIRLRIWNAPQDTTPGQNNYERTLAMAKRIKQHGLNFLLDFHY
SDNWADPAKQSLPAEWDNVSSIEELCSKVSEYTKKILTDLKSEGCAPDIIQIGNEINSGM
FLTKSDGTTTSSIDCYSWTEHTQGNKNLLKVLQSASSAVSEIDSSIKKMIHLASSKGDNF
DWWFKNLQNLKGVDYDYIGLSYYPFEEHGTLKQLRENIAYLKKTYKKQVLVAETSWAWSM
EAYGDSTNNIVWYDPAGIQAAKNLVDSKSTQLKNLKTQTYSGKKCVQASAQNQATVVKAI
MEATSNAGGCGVFYWGGDWIPNSKIQDTWENQTLFDLKGKALESLNVFLTE

Enzyme Prediction     

No EC number prediction in MGYG000003679_01661.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	40	408	2.6e-99	0.9941520467836257

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	2.59e-111	39	408	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	3.70e-96	33	408	34	391	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB14357.1	1.49e-292	1	411	1	411
AJG41448.1	4.14e-76	34	408	25	375
ACM23546.1	4.73e-76	34	408	31	381
ACB09953.1	1.30e-73	37	408	28	375
ABQ47562.1	1.48e-73	37	408	34	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	5.04e-69	3	408	7	391	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	1.23e-63	29	408	15	388	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	9.51e-63	29	408	15	388	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	1.64e-49	40	408	5	329	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	2.28e-42	40	408	5	329	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65CX5	1.54e-64	4	408	2	413	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
P48843	1.99e-63	38	406	6	344	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
O07013	1.92e-58	33	408	48	417	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
P83692	8.97e-49	40	408	5	329	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1
P48841	2.06e-46	36	408	25	365	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000278	0.244470	0.754882	0.000128	0.000125	0.000109

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003679_01661.